+ USE_DATABASE_REPLICATED=0
+ USE_SHARED_CATALOG=0
++ rg -v '#' /usr/share/zoneinfo/zone.tab
++ awk '{print $3}'
++ shuf
++ head -n1
+ TZ=America/Dawson
Chosen random timezone America/Dawson
+ echo 'Chosen random timezone America/Dawson'
+ ln -snf /usr/share/zoneinfo/America/Dawson /etc/localtime
+ echo America/Dawson
+ dpkg -i package_folder/clickhouse-common-static_24.8.14.10028.altinitytest+msan_amd64.deb
Selecting previously unselected package clickhouse-common-static.
(Reading database ... 48426 files and directories currently installed.)
Preparing to unpack .../clickhouse-common-static_24.8.14.10028.altinitytest+msan_amd64.deb ...
Unpacking clickhouse-common-static (24.8.14.10028.altinitytest+msan) ...
Setting up clickhouse-common-static (24.8.14.10028.altinitytest+msan) ...
+ dpkg -i package_folder/clickhouse-common-static-dbg_24.8.14.10028.altinitytest+msan_amd64.deb
Selecting previously unselected package clickhouse-common-static-dbg.
(Reading database ... 48453 files and directories currently installed.)
Preparing to unpack .../clickhouse-common-static-dbg_24.8.14.10028.altinitytest+msan_amd64.deb ...
Unpacking clickhouse-common-static-dbg (24.8.14.10028.altinitytest+msan) ...
Setting up clickhouse-common-static-dbg (24.8.14.10028.altinitytest+msan) ...
+ dpkg -i package_folder/clickhouse-odbc-bridge_24.8.14.10028.altinitytest+msan_amd64.deb
Selecting previously unselected package clickhouse-odbc-bridge.
(Reading database ... 48460 files and directories currently installed.)
Preparing to unpack .../clickhouse-odbc-bridge_24.8.14.10028.altinitytest+msan_amd64.deb ...
Unpacking clickhouse-odbc-bridge (24.8.14.10028.altinitytest+msan) ...
Setting up clickhouse-odbc-bridge (24.8.14.10028.altinitytest+msan) ...
+ dpkg -i package_folder/clickhouse-library-bridge_24.8.14.10028.altinitytest+msan_amd64.deb
Selecting previously unselected package clickhouse-library-bridge.
(Reading database ... 48466 files and directories currently installed.)
Preparing to unpack .../clickhouse-library-bridge_24.8.14.10028.altinitytest+msan_amd64.deb ...
Unpacking clickhouse-library-bridge (24.8.14.10028.altinitytest+msan) ...
Setting up clickhouse-library-bridge (24.8.14.10028.altinitytest+msan) ...
+ dpkg -i package_folder/clickhouse-server_24.8.14.10028.altinitytest+msan_amd64.deb
Selecting previously unselected package clickhouse-server.
(Reading database ... 48472 files and directories currently installed.)
Preparing to unpack .../clickhouse-server_24.8.14.10028.altinitytest+msan_amd64.deb ...
Unpacking clickhouse-server (24.8.14.10028.altinitytest+msan) ...
Setting up clickhouse-server (24.8.14.10028.altinitytest+msan) ...
ClickHouse binary is already located at /usr/bin/clickhouse
Symlink /usr/bin/clickhouse-server already exists but it points to /clickhouse. Will replace the old symlink to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-server to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-client to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-local to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-benchmark to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-obfuscator to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-git-import to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-compressor to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-format to /usr/bin/clickhouse.
Symlink /usr/bin/clickhouse-extract-from-config already exists but it points to /clickhouse. Will replace the old symlink to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-extract-from-config to /usr/bin/clickhouse.
Symlink /usr/bin/clickhouse-keeper already exists but it points to /clickhouse. Will replace the old symlink to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-keeper to /usr/bin/clickhouse.
Symlink /usr/bin/clickhouse-keeper-converter already exists but it points to /clickhouse. Will replace the old symlink to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-keeper-converter to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-disks to /usr/bin/clickhouse.
Creating symlink /usr/bin/ch to /usr/bin/clickhouse.
Creating symlink /usr/bin/chl to /usr/bin/clickhouse.
Creating symlink /usr/bin/chc to /usr/bin/clickhouse.
Creating clickhouse group if it does not exist.
groupadd -r clickhouse
Creating clickhouse user if it does not exist.
useradd -r --shell /bin/false --home-dir /nonexistent -g clickhouse clickhouse
Will set ulimits for clickhouse user in /etc/security/limits.d/clickhouse.conf.
Creating config directory /etc/clickhouse-server/config.d that is used for tweaks of main server configuration.
Creating config directory /etc/clickhouse-server/users.d that is used for tweaks of users configuration.
Config file /etc/clickhouse-server/config.xml already exists, will keep it and extract path info from it.
/etc/clickhouse-server/config.xml has /var/lib/clickhouse/ as data path.
/etc/clickhouse-server/config.xml has /var/log/clickhouse-server/ as log path.
Users config file /etc/clickhouse-server/users.xml already exists, will keep it and extract users info from it.
Log directory /var/log/clickhouse-server/ already exists.
Creating data directory /var/lib/clickhouse/.
Creating pid directory /var/run/clickhouse-server.
chown -R clickhouse:clickhouse '/var/log/clickhouse-server/'
chown -R clickhouse:clickhouse '/var/run/clickhouse-server'
chown clickhouse:clickhouse '/var/lib/clickhouse/'
groupadd -r clickhouse-bridge
useradd -r --shell /bin/false --home-dir /nonexistent -g clickhouse-bridge clickhouse-bridge
chown -R clickhouse-bridge:clickhouse-bridge '/usr/bin/clickhouse-odbc-bridge'
chown -R clickhouse-bridge:clickhouse-bridge '/usr/bin/clickhouse-library-bridge'
Password for the default user is an empty string. See /etc/clickhouse-server/users.xml and /etc/clickhouse-server/users.d to change it.
Setting capabilities for clickhouse binary. This is optional.
chown -R clickhouse:clickhouse '/etc/clickhouse-server'
ClickHouse has been successfully installed.
Start clickhouse-server with:
sudo clickhouse start
Start clickhouse-client with:
clickhouse-client
+ dpkg -i package_folder/clickhouse-client_24.8.14.10028.altinitytest+msan_amd64.deb
Selecting previously unselected package clickhouse-client.
(Reading database ... 48489 files and directories currently installed.)
Preparing to unpack .../clickhouse-client_24.8.14.10028.altinitytest+msan_amd64.deb ...
Unpacking clickhouse-client (24.8.14.10028.altinitytest+msan) ...
Setting up clickhouse-client (24.8.14.10028.altinitytest+msan) ...
+ echo ''
+ [[ -z '' ]]
+ ch --query 'SELECT 1'
1
+ chl --query 'SELECT 1'
1
+ chc --version
ClickHouse client version 24.8.14.10028.altinitytest (altinity build).
+ ln -s /usr/share/clickhouse-test/clickhouse-test /usr/bin/clickhouse-test
+ source /attach_gdb.lib
++ source /utils.lib
+++ sysctl kernel.core_pattern=core.%e.%p-%P
kernel.core_pattern = core.%e.%p-%P
+++ sysctl fs.suid_dumpable=1
fs.suid_dumpable = 1
+ source /utils.lib
++ sysctl kernel.core_pattern=core.%e.%p-%P
kernel.core_pattern = core.%e.%p-%P
++ sysctl fs.suid_dumpable=1
fs.suid_dumpable = 1
+ /usr/share/clickhouse-test/config/install.sh
+ DEST_SERVER_PATH=/etc/clickhouse-server
+ DEST_CLIENT_PATH=/etc/clickhouse-client
+++ dirname /usr/share/clickhouse-test/config/install.sh
++ cd /usr/share/clickhouse-test/config
++ pwd -P
+ SRC_PATH=/usr/share/clickhouse-test/config
+ echo 'Going to install test configs from /usr/share/clickhouse-test/config into /etc/clickhouse-server'
Going to install test configs from /usr/share/clickhouse-test/config into /etc/clickhouse-server
+ mkdir -p /etc/clickhouse-server/config.d/
+ mkdir -p /etc/clickhouse-server/users.d/
+ mkdir -p /etc/clickhouse-client
+ ln -sf /usr/share/clickhouse-test/config/config.d/zookeeper_write.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/max_num_to_warn.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/listen.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/text_log.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/blob_storage_log.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/custom_settings_prefixes.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/database_catalog_drop_table_concurrency.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/enable_access_control_improvements.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/macros.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/secure_ports.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/clusters.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/graphite.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/graphite_alternative.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/grpc_protocol.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/database_atomic.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/max_concurrent_queries.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/merge_tree_settings.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/backoff_failed_mutation.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/merge_tree_old_dirs_cleanup.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/test_cluster_with_incorrect_pw.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/keeper_port.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/logging_no_rotate.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/merge_tree.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/lost_forever_check.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/tcp_with_proxy.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/prometheus.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/top_level_domains_lists.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/top_level_domains_path.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/transactions.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/encryption.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/CORS.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/zookeeper_log.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/logger_trace.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/named_collection.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/ssl_certs.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/filesystem_cache_log.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/session_log.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/system_unfreeze.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/enable_zero_copy_replication.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/nlp.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/forbidden_headers.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/enable_keeper_map.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/custom_disks_base_path.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/display_name.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/compressed_marks_and_index.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/disable_s3_env_credentials.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/enable_wait_for_shutdown_replicated_tables.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/backups.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/filesystem_caches_path.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/validate_tcp_client_information.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/zero_copy_destructive_operations.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/block_number.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/handlers.yaml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/serverwide_trace_collector.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/rocksdb.xml /etc/clickhouse-server/config.d/
+ '[' /etc/clickhouse-server = /etc/clickhouse-server ']'
+ ln -sf /usr/share/clickhouse-test/config/config.d/legacy_geobase.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/log_queries.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/readonly.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/access_management.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/database_atomic_drop_detach_sync.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/opentelemetry.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/remote_queries.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/session_log_test.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/memory_profiler.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/no_fsync_metadata.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/filelog.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/enable_blobs_check.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/marks.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/insert_keeper_retries.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/prefetch_settings.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/nonconst_timezone.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/allow_introspection_functions.yaml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/replicated_ddl_entry.xml /etc/clickhouse-server/users.d/
+ [[ -n '' ]]
+ ln -sf /usr/share/clickhouse-test/config/users.d/timeouts.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/ints_dictionary.xml /etc/clickhouse-server/
+ ln -sf /usr/share/clickhouse-test/config/strings_dictionary.xml /etc/clickhouse-server/
+ ln -sf /usr/share/clickhouse-test/config/decimals_dictionary.xml /etc/clickhouse-server/
+ ln -sf /usr/share/clickhouse-test/config/executable_dictionary.xml /etc/clickhouse-server/
+ ln -sf /usr/share/clickhouse-test/config/executable_pool_dictionary.xml /etc/clickhouse-server/
+ ln -sf /usr/share/clickhouse-test/config/test_function.xml /etc/clickhouse-server/
+ ln -sf /usr/share/clickhouse-test/config/top_level_domains /etc/clickhouse-server/
+ ln -sf /usr/share/clickhouse-test/config/regions_hierarchy.txt /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/regions_names_en.txt /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/ext-en.txt /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/ext-ru.txt /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/lem-en.bin /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/server.key /etc/clickhouse-server/
+ ln -sf /usr/share/clickhouse-test/config/server.crt /etc/clickhouse-server/
+ ln -sf /usr/share/clickhouse-test/config/dhparam.pem /etc/clickhouse-server/
+ ln -sf --backup=simple --suffix=_original.xml /usr/share/clickhouse-test/config/config.d/query_masking_rules.xml /etc/clickhouse-server/config.d/
+ [[ -n '' ]]
+ rm -f /etc/clickhouse-server/config.d/zookeeper_fault_injection.xml
+ ln -sf /usr/share/clickhouse-test/config/config.d/zookeeper.xml /etc/clickhouse-server/config.d/
+ [[ -n '' ]]
+ rm -f /etc/clickhouse-server/config.d/cannot_allocate_thread_injection.xml
+ value=0
+ sed --follow-symlinks -i 's|[01]|0|' /etc/clickhouse-server/config.d/keeper_port.xml
+ value=20643840
+ sed --follow-symlinks -i 's|[[:digit:]]\+|20643840|' /etc/clickhouse-server/config.d/keeper_port.xml
+ value=60327936
+ sed --follow-symlinks -i 's|[[:digit:]]\+|60327936|' /etc/clickhouse-server/config.d/keeper_port.xml
+ [[ -n '' ]]
+ [[ -n '' ]]
+ [[ '' == \1 ]]
+ [[ '' == \1 ]]
+ [[ -n 1 ]]
+ ln -sf /usr/share/clickhouse-test/config/config.d/azure_storage_conf.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/storage_conf.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/storage_conf_02944.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/storage_conf_02963.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/storage_conf_02961.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/s3_cache.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/s3_cache_new.xml /etc/clickhouse-server/users.d/
+ [[ -n 0 ]]
+ [[ 0 -eq 1 ]]
+ ln -sf /usr/share/clickhouse-test/config/client_config.xml /etc/clickhouse-client/config.xml
+ [[ -n 0 ]]
+ [[ 0 -eq 1 ]]
+ ./setup_minio.sh stateless
+ azurite-blob --blobHost 0.0.0.0 --blobPort 10000 --debug /azurite_log
+ export MINIO_ROOT_USER=clickhouse
+ MINIO_ROOT_USER=clickhouse
+ export MINIO_ROOT_PASSWORD=clickhouse
+ MINIO_ROOT_PASSWORD=clickhouse
+ main stateless
+ local query_dir
++ check_arg stateless
++ local query_dir
++ '[' '!' 1 -eq 1 ']'
++ case "$1" in
++ query_dir=0_stateless
++ echo 0_stateless
+ query_dir=0_stateless
+ '[' '!' -f ./minio ']'
+ start_minio
+ mkdir -p ./minio_data
+ ./minio --version
minio version RELEASE.2024-08-03T04-33-23Z (commit-id=6efb56851c40da88d1ca15112e2d686a4ecec6b3)
Runtime: go1.22.5 linux/amd64
License: GNU AGPLv3 - https://www.gnu.org/licenses/agpl-3.0.html
Copyright: 2015-2024 MinIO, Inc.
+ wait_for_it
+ local counter=0
+ local max_counter=60
+ local url=http://localhost:11111
+ params=('--silent' '--verbose')
+ ./minio server --address :11111 ./minio_data
+ local params
+ curl --silent --verbose http://localhost:11111
+ grep AccessDenied
+ [[ 0 == \6\0 ]]
+ echo 'trying to connect to minio'
+ sleep 1
trying to connect to minio
Azurite Blob service is starting on 0.0.0.0:10000
Azurite Blob service successfully listens on http://0.0.0.0:10000
INFO: Formatting 1st pool, 1 set(s), 1 drives per set.
INFO: WARNING: Host local has more than 0 drives of set. A host failure will result in data becoming unavailable.
MinIO Object Storage Server
Copyright: 2015-2025 MinIO, Inc.
License: GNU AGPLv3 - https://www.gnu.org/licenses/agpl-3.0.html
Version: RELEASE.2024-08-03T04-33-23Z (go1.22.5 linux/amd64)
API: http://172.17.0.2:11111 http://127.0.0.1:11111
WebUI: http://172.17.0.2:42479 http://127.0.0.1:42479
Docs: https://min.io/docs/minio/linux/index.html
+ counter=1
+ curl --silent --verbose http://localhost:11111
+ grep AccessDenied
AccessDeniedAccess Denied./1845C81A68D7CA4B7dc7eb22d3288ec80374614e9088e31d3668a6922ead55932dd2a8e56373820f
+ lsof -i :11111
COMMAND PID USER FD TYPE DEVICE SIZE/OFF NODE NAME
minio 283 root 8u IPv6 35970 0t0 TCP *:11111 (LISTEN)
minio 283 root 9u IPv4 35969 0t0 TCP localhost:11111 (LISTEN)
minio 283 root 10u IPv6 35971 0t0 TCP localhost:11111 (LISTEN)
+ sleep 5
+ setup_minio stateless
+ local test_type=stateless
+ ./mc alias set clickminio http://localhost:11111 clickhouse clickhouse
Added `clickminio` successfully.
+ ./mc admin user add clickminio test testtest
Added user `test` successfully.
+ ./mc admin policy attach clickminio readwrite --user=test
Attached Policies: [readwrite]
To User: test
+ ./mc mb --ignore-existing clickminio/test
Bucket created successfully `clickminio/test`.
+ '[' stateless = stateless ']'
+ ./mc anonymous set public clickminio/test
Access permission for `clickminio/test` is set to `public`
+ upload_data 0_stateless /usr/share/clickhouse-test
+ local query_dir=0_stateless
+ local test_path=/usr/share/clickhouse-test
+ local data_path=/usr/share/clickhouse-test/queries/0_stateless/data_minio
+ '[' -d /usr/share/clickhouse-test/queries/0_stateless/data_minio ']'
+ ./mc cp --recursive /usr/share/clickhouse-test/queries/0_stateless/data_minio/ clickminio/test/
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/02731.parquet` -> `clickminio/test/02731.parquet`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/02366_data.jsonl` -> `clickminio/test/02366_data.jsonl`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_archive1.zip` -> `clickminio/test/03036_archive1.zip`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/02731.arrow` -> `clickminio/test/02731.arrow`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/02876.parquet` -> `clickminio/test/02876.parquet`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_archive1.tar` -> `clickminio/test/03036_archive1.tar`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_archive2.tar` -> `clickminio/test/03036_archive2.tar`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_archive2.zip` -> `clickminio/test/03036_archive2.zip`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_archive3.tar.gz` -> `clickminio/test/03036_archive3.tar.gz`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_compressed_file_archive.zip` -> `clickminio/test/03036_compressed_file_archive.zip`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_json_archive.zip` -> `clickminio/test/03036_json_archive.zip`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/a.tsv` -> `clickminio/test/a.tsv`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/b.tsv` -> `clickminio/test/b.tsv`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/c.tsv` -> `clickminio/test/c.tsv`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/hive_partitioning/column0=Elizabeth/column1=Gordon/sample.parquet` -> `clickminio/test/hive_partitioning/column0=Elizabeth/column1=Gordon/sample.parquet`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/hive_partitioning/column0=Elizabeth/column1=Schmidt/sample.parquet` -> `clickminio/test/hive_partitioning/column0=Elizabeth/column1=Schmidt/sample.parquet`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/hive_partitioning/column0=Elizabeth/sample.parquet` -> `clickminio/test/hive_partitioning/column0=Elizabeth/sample.parquet`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/hive_partitioning/non_existing_column=Elizabeth/sample.parquet` -> `clickminio/test/hive_partitioning/non_existing_column=Elizabeth/sample.parquet`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/json_data` -> `clickminio/test/json_data`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/tsv_with_header.tsv` -> `clickminio/test/tsv_with_header.tsv`
Total: 5.42 MiB, Transferred: 5.42 MiB, Speed: 123.74 MiB/s
+ setup_aws_credentials
+ local minio_root_user=clickhouse
+ local minio_root_password=clickhouse
+ mkdir -p /root/.aws
+ cat
+ ./setup_hdfs_minicluster.sh
+ ls -lha
total 125M
drwxr-xr-x 1 root root 4.0K Jun 4 01:00 .
drwxr-xr-x 1 root root 4.0K Jun 4 01:00 ..
-rw-rw-r-- 1 1000 1000 119 Jun 4 00:56 analyzer_tech_debt.txt
-rw-rw-r-- 1 root root 2.4K Jan 31 08:43 attach_gdb.lib
-rw-r--r-- 1 root root 1.3K Jun 4 01:00 __azurite_db_blob_extent__.json
-rw-r--r-- 1 root root 3.9K Jun 4 01:00 __azurite_db_blob__.json
-rw-r--r-- 1 root root 1.4K Jun 4 01:00 azurite_log
lrwxrwxrwx 1 root root 7 Sep 11 2024 bin -> usr/bin
drwxr-xr-x 2 root root 4.0K Jun 4 01:00 __blobstorage__
drwxr-xr-x 2 root root 4.0K Apr 18 2022 boot
-rw-rw-r-- 1 1000 1000 292 Jun 4 00:56 broken_tests.json
drwxr-xr-x 14 root root 3.8K Jun 4 01:00 dev
-rwxr-xr-x 1 root root 0 Jun 4 01:00 .dockerenv
drwxr-xr-x 1 root root 4.0K Jun 4 01:00 etc
drwxr-xr-x 10 1000 1000 4.0K Jun 14 2021 hadoop-3.3.1
drwxr-xr-x 2 root root 4.0K Apr 18 2022 home
lrwxrwxrwx 1 root root 7 Sep 11 2024 lib -> usr/lib
lrwxrwxrwx 1 root root 9 Sep 11 2024 lib32 -> usr/lib32
lrwxrwxrwx 1 root root 9 Sep 11 2024 lib64 -> usr/lib64
lrwxrwxrwx 1 root root 10 Sep 11 2024 libx32 -> usr/libx32
-rwxr-xr-x 1 root root 26M Jan 31 09:05 mc
drwxr-xr-x 2 root root 4.0K Sep 11 2024 media
-rwxr-xr-x 1 root root 99M Jan 31 09:03 minio
drwxr-xr-x 4 root root 4.0K Jun 4 01:00 minio_data
drwxr-xr-x 2 root root 4.0K Sep 11 2024 mnt
drwxr-xr-x 1 root root 4.0K Jan 31 08:44 opt
-rw-r--r-- 1 root root 0 Feb 14 2024 .package-cache-mutate
drwxrwxr-x 2 1000 1000 4.0K Jun 4 01:00 package_folder
dr-xr-xr-x 309 root root 0 Jun 4 01:00 proc
-rwxrwxr-x 1 root root 9.5K Jan 31 08:43 process_functional_tests_result.py
-rw-rw-r-- 1 root root 837 Jan 31 08:43 requirements.txt
drwx------ 1 root root 4.0K Jun 4 01:00 root
drwxr-xr-x 1 root root 4.0K Jun 4 01:00 run
-rwxrwxr-x 1 root root 22K Jan 31 08:43 run.sh
lrwxrwxrwx 1 root root 8 Sep 11 2024 sbin -> usr/sbin
-rwxrwxr-x 1 root root 11K Jan 31 08:43 setup_export_logs.sh
-rwxrwxr-x 1 root root 360 Jan 31 08:43 setup_hdfs_minicluster.sh
-rwxrwxr-x 1 root root 3.4K Jan 31 08:43 setup_minio.sh
drwxr-xr-x 2 root root 4.0K Sep 11 2024 srv
-rw-rw-r-- 1 root root 14K Jan 31 08:43 stress_tests.lib
dr-xr-xr-x 13 root root 0 Jun 4 01:00 sys
drwxrwxr-x 2 1000 1000 4.0K Jun 4 01:00 test_output
drwxrwxrwt 1 root root 4.0K Jan 31 09:03 tmp
drwxr-xr-x 1 root root 4.0K Sep 11 2024 usr
-rw-rw-r-- 1 root root 897 Jan 31 08:43 utils.lib
drwxr-xr-x 1 root root 4.0K Sep 11 2024 var
+ cd hadoop-3.3.1
+ export JAVA_HOME=/usr
+ JAVA_HOME=/usr
+ mkdir -p target/test/data
+ chown clickhouse ./target/test/data
+ nc -z localhost 12222
+ sudo -E -u clickhouse bin/mapred minicluster -format -nomr -nnport 12222
+ sleep 1
+ nc -z localhost 12222
+ sleep 1
+ nc -z localhost 12222
+ lsof -i :12222
COMMAND PID USER FD TYPE DEVICE SIZE/OFF NODE NAME
java 407 clickhouse 322u IPv4 15084 0t0 TCP localhost:12222 (LISTEN)
java 407 clickhouse 544u IPv4 21132 0t0 TCP localhost:50254->localhost:12222 (ESTABLISHED)
java 407 clickhouse 549u IPv4 32175 0t0 TCP localhost:12222->localhost:50254 (ESTABLISHED)
+ sleep 5
+ config_logs_export_cluster /etc/clickhouse-server/config.d/system_logs_export.yaml
+ set +x
File /tmp/export-logs-config.sh does not exist, do not setup
+ [[ -n '' ]]
+ export IS_FLAKY_CHECK=0
+ IS_FLAKY_CHECK=0
+ '[' 1 -gt 1 ']'
+ sudo -E -u clickhouse /usr/bin/clickhouse-server --config /etc/clickhouse-server/config.xml --daemon --pid-file /var/run/clickhouse-server/clickhouse-server.pid
+ [[ 0 -eq 1 ]]
+ [[ 0 -eq 1 ]]
+ for _ in {1..100}
+ clickhouse-client --query 'SELECT 1'
Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR)
+ sleep 1
+ for _ in {1..100}
+ clickhouse-client --query 'SELECT 1'
Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR)
+ sleep 1
+ for _ in {1..100}
+ clickhouse-client --query 'SELECT 1'
Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR)
+ sleep 1
+ for _ in {1..100}
+ clickhouse-client --query 'SELECT 1'
Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR)
+ sleep 1
+ for _ in {1..100}
+ clickhouse-client --query 'SELECT 1'
Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR)
+ sleep 1
+ for _ in {1..100}
+ clickhouse-client --query 'SELECT 1'
Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR)
+ sleep 1
+ for _ in {1..100}
+ clickhouse-client --query 'SELECT 1'
Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR)
+ sleep 1
+ for _ in {1..100}
+ clickhouse-client --query 'SELECT 1'
Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR)
+ sleep 1
+ for _ in {1..100}
+ clickhouse-client --query 'SELECT 1'
Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR)
+ sleep 1
127.0.0.1 - - [04/Jun/2025:08:01:09 +0000] "GET /devstoreaccount1/cont?restype=container HTTP/1.1" 404 -
127.0.0.1 - - [04/Jun/2025:08:01:09 +0000] "PUT /devstoreaccount1/cont?restype=container HTTP/1.1" 201 -
127.0.0.1 - - [04/Jun/2025:08:01:09 +0000] "PUT /devstoreaccount1/cont/trcizfwqvbbalzaodohcfthphkagrusd HTTP/1.1" 201 -
127.0.0.1 - - [04/Jun/2025:08:01:09 +0000] "GET /devstoreaccount1/cont/trcizfwqvbbalzaodohcfthphkagrusd HTTP/1.1" 206 4
127.0.0.1 - - [04/Jun/2025:08:01:09 +0000] "GET /devstoreaccount1/cont/trcizfwqvbbalzaodohcfthphkagrusd HTTP/1.1" 206 2
127.0.0.1 - - [04/Jun/2025:08:01:09 +0000] "DELETE /devstoreaccount1/cont/trcizfwqvbbalzaodohcfthphkagrusd HTTP/1.1" 202 -
+ for _ in {1..100}
+ clickhouse-client --query 'SELECT 1'
1
+ break
+ setup_logs_replication
File /tmp/export-logs-config.sh does not exist, do not setup
+ set +x
+ attach_gdb_to_clickhouse
++ run_with_retry 5 clickhouse-client --query 'SELECT count() FROM system.build_options WHERE name = '\''CXX_FLAGS'\'' AND position('\''sanitize=address'\'' IN value)'
++ [[ ahxB =~ e ]]
++ set_e=false
++ set +e
++ local total_retries=5
++ shift
++ local retry=0
++ '[' 0 -ge 5 ']'
++ clickhouse-client --query 'SELECT count() FROM system.build_options WHERE name = '\''CXX_FLAGS'\'' AND position('\''sanitize=address'\'' IN value)'
++ false
++ return
+ IS_ASAN=0
+ [[ 0 = \1 ]]
++ kill -l SIGRTMIN
+ RTMIN=34
+ echo '
set follow-fork-mode parent
handle SIGHUP nostop noprint pass
handle SIGINT nostop noprint pass
handle SIGQUIT nostop noprint pass
handle SIGPIPE nostop noprint pass
handle SIGTERM nostop noprint pass
handle SIGUSR1 nostop noprint pass
handle SIGUSR2 nostop noprint pass
handle SIG34 nostop noprint pass
info signals
continue
backtrace full
info registers
p top' 1 KiB of the 'stack:
p/x *(uint64_t[128]*)$sp
maintenance info sections
thread apply all backtrace full
disassemble /s
up
disassemble /s
up
disassemble /s
p "done"
detach
quit
'
+ sleep 5
+ ts '%Y-%m-%d %H:%M:%S'
++ cat /var/run/clickhouse-server/clickhouse-server.pid
+ gdb -batch -command script.gdb -p 592
+ run_with_retry 60 clickhouse-client --query 'SELECT '\''Connected to clickhouse-server after attaching gdb'\'''
+ [[ aehxB =~ e ]]
+ set_e=true
+ set +e
+ local total_retries=60
+ shift
+ local retry=0
+ '[' 0 -ge 60 ']'
+ clickhouse-client --query 'SELECT '\''Connected to clickhouse-server after attaching gdb'\'''
Connected to clickhouse-server after attaching gdb
+ true
+ set -e
+ return
+ clickhouse-client --query 'CREATE TABLE minio_audit_logs
(
log String,
event_time DateTime64(9) MATERIALIZED parseDateTime64BestEffortOrZero(trim(BOTH '\''"'\'' FROM JSONExtractRaw(log, '\''time'\'')), 9, '\''UTC'\'')
)
ENGINE = MergeTree
ORDER BY tuple()'
+ clickhouse-client --query 'CREATE TABLE minio_server_logs
(
log String,
event_time DateTime64(9) MATERIALIZED parseDateTime64BestEffortOrZero(trim(BOTH '\''"'\'' FROM JSONExtractRaw(log, '\''time'\'')), 9, '\''UTC'\'')
)
ENGINE = MergeTree
ORDER BY tuple()'
+ ./mc admin config set clickminio logger_webhook:ch_server_webhook 'endpoint=http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_server_logs%20FORMAT%20LineAsString' queue_size=1000000 batch_size=500
Successfully applied new settings.
+ ./mc admin config set clickminio audit_webhook:ch_audit_webhook 'endpoint=http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString' queue_size=1000000 batch_size=500
Successfully applied new settings.
+ max_retries=100
+ retry=1
+ '[' 1 -le 100 ']'
+ echo 'clickminio restart attempt 1:'
clickminio restart attempt 1:
++ ./mc admin service restart clickminio --wait --json
++ jq -r .status
INFO: Restarting on service signal
MinIO Object Storage Server
Copyright: 2015-2025 MinIO, Inc.
License: GNU AGPLv3 - https://www.gnu.org/licenses/agpl-3.0.html
Version: RELEASE.2024-08-03T04-33-23Z (go1.22.5 linux/amd64)
API: http://172.17.0.2:11111 http://127.0.0.1:11111
WebUI: http://172.17.0.2:39627 http://127.0.0.1:39627
Docs: https://min.io/docs/minio/linux/index.html
Output of restart status: success
success
Restarted clickminio successfully.
+ output='success
success'
+ echo 'Output of restart status: success
success'
+ expected_output='success
success'
+ '[' 'success
success' = 'success
success' ']'
+ echo 'Restarted clickminio successfully.'
+ break
+ '[' 1 -gt 100 ']'
+ MC_ADMIN_PID=1481
+ ./mc admin trace clickminio
+ export -f run_tests
+ '[' 1 -gt 1 ']'
+ run_tests
+ set -x
+ read -ra ADDITIONAL_OPTIONS
+ HIGH_LEVEL_COVERAGE=YES
+ '[' 1 -gt 1 ']'
+ [[ -n '' ]]
+ [[ -n '' ]]
+ [[ 0 -eq 1 ]]
+ [[ '' -eq 1 ]]
+ [[ 0 -eq 1 ]]
++ clickhouse-client --query 'SELECT value LIKE '\''%SANITIZE_COVERAGE%'\'' FROM system.build_options WHERE name = '\''CXX_FLAGS'\'''
+ [[ 1 == 0 ]]
+ ADDITIONAL_OPTIONS+=('--jobs')
+ ADDITIONAL_OPTIONS+=('8')
+ [[ -n 2 ]]
+ [[ -n 4 ]]
+ ADDITIONAL_OPTIONS+=('--run-by-hash-num')
+ ADDITIONAL_OPTIONS+=("$RUN_BY_HASH_NUM")
+ ADDITIONAL_OPTIONS+=('--run-by-hash-total')
+ ADDITIONAL_OPTIONS+=("$RUN_BY_HASH_TOTAL")
+ HIGH_LEVEL_COVERAGE=NO
+ [[ -n '' ]]
+ [[ NO = \Y\E\S ]]
+ ADDITIONAL_OPTIONS+=('--report-logs-stats')
+ try_run_with_retry 10 clickhouse-client -q 'insert into system.zookeeper (name, path, value) values ('\''auxiliary_zookeeper2'\'', '\''/test/chroot/'\'', '\'''\'')'
+ local total_retries=10
+ shift
+ fn_exists run_with_retry
+ declare -F run_with_retry
+ run_with_retry 10 clickhouse-client -q 'insert into system.zookeeper (name, path, value) values ('\''auxiliary_zookeeper2'\'', '\''/test/chroot/'\'', '\'''\'')'
+ [[ aehxB =~ e ]]
+ set_e=true
+ set +e
+ local total_retries=10
+ shift
+ local retry=0
+ '[' 0 -ge 10 ']'
+ clickhouse-client -q 'insert into system.zookeeper (name, path, value) values ('\''auxiliary_zookeeper2'\'', '\''/test/chroot/'\'', '\'''\'')'
+ true
+ set -e
+ return
+ set +e
+ TEST_ARGS=(--testname --shard --zookeeper --check-zookeeper-session --hung-check --print-time --no-drop-if-fail --capture-client-stacktrace --test-runs "$NUM_TRIES" "${ADDITIONAL_OPTIONS[@]}")
+ clickhouse-test --testname --shard --zookeeper --check-zookeeper-session --hung-check --print-time --no-drop-if-fail --capture-client-stacktrace --test-runs 1 --hung-check --print-time --jobs 8 --run-by-hash-num 2 --run-by-hash-total 4 --report-logs-stats
+ ts '%Y-%m-%d %H:%M:%S'
+ tee -a test_output/test_result.txt
2025-06-04 01:01:18 Using queries from '/usr/share/clickhouse-test/queries' directory
2025-06-04 01:01:18 Connecting to ClickHouse server... OK
2025-06-04 01:01:18 Connected to server 24.8.14.10028.altinitytest @ 26cde36666d2d6cc9dfb4a4bae80ad1b5f89df57 HEAD
2025-06-04 01:01:19 Found 1606 parallel tests and 126 sequential tests
2025-06-04 01:01:20 Running about 200 stateless tests (Process-4).
2025-06-04 01:01:20 02675_predicate_push_down_filled_join_fix: [ OK ] 0.93 sec.
2025-06-04 01:01:20 Running about 200 stateless tests (Process-9).
2025-06-04 01:01:20 02962_parallel_window_functions_different_partitioning: [ OK ] 0.99 sec.
2025-06-04 01:01:20 Running about 200 stateless tests (Process-8).
2025-06-04 01:01:20 02835_fuzz_remove_redundant_sorting: [ OK ] 1.29 sec.
2025-06-04 01:01:21 00803_odbc_driver_2_format: [ OK ] 0.74 sec.
2025-06-04 01:01:21 Running about 200 stateless tests (Process-6).
2025-06-04 01:01:21 02884_parquet_new_encodings: [ OK ] 2.15 sec.
2025-06-04 01:01:21 02884_duplicate_index_name: [ OK ] 0.93 sec.
2025-06-04 01:01:22 00647_multiply_aggregation_state: [ OK ] 1.68 sec.
2025-06-04 01:01:22 Running about 200 stateless tests (Process-5).
2025-06-04 01:01:22 02372_now_in_block: [ OK ] 3.10 sec.
2025-06-04 01:01:22 02313_cross_join_dup_col_names: [ OK ] 0.63 sec.
2025-06-04 01:01:23 02554_log_faminy_support_storage_policy: [ OK ] 1.48 sec.
2025-06-04 01:01:23 02025_subcolumns_compact_parts: [ OK ] 1.08 sec.
2025-06-04 01:01:24 02693_multiple_joins_in: [ OK ] 1.23 sec.
2025-06-04 01:01:24 01921_with_fill_with_totals: [ OK ] 1.73 sec.
2025-06-04 01:01:25 01615_two_args_function_index_fix: [ OK ] 1.60 sec.
2025-06-04 01:01:27 Running about 200 stateless tests (Process-3).
2025-06-04 01:01:27 01283_strict_resize_bug: [ OK ] 7.66 sec.
2025-06-04 01:01:28 01214_test_storage_merge_aliases_with_where: [ OK ] 2.15 sec.
2025-06-04 01:01:28 02903_bug_43644: [ OK ] 1.23 sec.
2025-06-04 01:01:29 00098_f_union_all: [ OK ] 1.44 sec.
2025-06-04 01:01:30 02043_query_obfuscator_embedded_dictionaries: [ OK ] 2.15 sec.
2025-06-04 01:01:31 01280_unicode_whitespaces_lexer: [ OK ] 1.11 sec.
2025-06-04 01:01:34 02732_rename_after_processing: [ OK ] 13.10 sec.
2025-06-04 01:01:35 Running about 200 stateless tests (Process-7).
2025-06-04 01:01:35 02423_insert_stats_behaviour: [ OK ] 16.09 sec.
2025-06-04 01:01:35 01940_totimezone_operator_monotonicity: [ OK ] 1.27 sec.
2025-06-04 01:01:36 Running about 200 stateless tests (Process-10).
2025-06-04 01:01:36 00900_orc_arrow_parquet_tuples: [ OK ] 16.89 sec.
2025-06-04 01:01:36 01165_lost_part_empty_partition: [ OK ] 11.82 sec.
2025-06-04 01:01:36 02430_initialize_aggregation_with_combinators: [ OK ] 1.36 sec.
2025-06-04 01:01:37 02340_union_header: [ OK ] 1.46 sec.
2025-06-04 01:01:38 01070_alter_with_ttl: [ OK ] 1.48 sec.
2025-06-04 01:01:39 02574_suspicious_low_cardinality_msan: [ OK ] 2.16 sec.
2025-06-04 01:01:39 02890_untuple_column_names: [ OK ] 3.09 sec.
2025-06-04 01:01:39 00098_k_union_all: [ OK ] 1.00 sec.
2025-06-04 01:01:39 03038_nested_dynamic_merges_compact_vertical: [ SKIPPED ] 0.00 sec.
2025-06-04 01:01:39 Reason: not running for current build
2025-06-04 01:01:40 02493_inconsistent_hex_and_binary_number: [ OK ] 9.30 sec.
2025-06-04 01:01:40 02784_disable_async_with_dedup_correctly: [ OK ] 10.19 sec.
2025-06-04 01:01:42 02998_projection_after_attach_partition: [ OK ] 2.50 sec.
2025-06-04 01:01:43 00063_check_query: [ OK ] 2.56 sec.
2025-06-04 01:01:44 01451_replicated_detach_drop_part_long: [ OK ] 4.72 sec.
2025-06-04 01:01:44 02030_client_unknown_database: [ OK ] 3.51 sec.
2025-06-04 01:01:44 03065_analyzer_cross_join_and_array_join: [ OK ] 1.43 sec.
2025-06-04 01:01:45 01280_min_map_max_map: [ OK ] 3.05 sec.
2025-06-04 01:01:45 02499_escaped_quote_schema_inference: [ OK ] 0.97 sec.
2025-06-04 01:01:46 01680_predicate_pushdown_union_distinct_subquery: [ OK ] 1.24 sec.
2025-06-04 01:01:46 01710_projection_external_aggregate: [ OK ] 2.67 sec.
2025-06-04 01:01:47 03203_system_numbers_limit_and_offset_complex: [ OK ] 1.61 sec.
2025-06-04 01:01:48 00262_alter_alias: [ OK ] 1.77 sec.
2025-06-04 01:01:50 02676_trailing_commas: [ OK ] 1.45 sec.
2025-06-04 01:01:52 02571_local_desc_abort_on_twitter_json: [ OK ] 5.32 sec.
2025-06-04 01:01:53 02461_cancel_finish_race: [ OK ] 31.43 sec.
2025-06-04 01:01:53 02354_tuple_element_with_default: [ OK ] 1.49 sec.
2025-06-04 01:01:54 02122_parallel_formatting_TSV: [ OK ] 10.13 sec.
2025-06-04 01:01:54 01211_optimize_skip_unused_shards_type_mismatch: [ OK ] 1.44 sec.
2025-06-04 01:01:55 01097_cyclic_defaults: [ OK ] 5.47 sec.
2025-06-04 01:01:56 01459_default_value_of_argument_type_nullptr_dereference: [ OK ] 1.35 sec.
2025-06-04 01:01:56 01686_rocksdb: [ OK ] 2.63 sec.
2025-06-04 01:01:56 03003_prql_panic: [ OK ] 2.23 sec.
2025-06-04 01:01:57 03305_fix_kafka_table_with_kw_arguments: [ OK ] 0.99 sec.
2025-06-04 01:01:57 01772_to_start_of_hour_align: [ OK ] 1.45 sec.
2025-06-04 01:01:57 03008_uniq_exact_equal_ranges: [ OK ] 20.19 sec.
2025-06-04 01:01:58 00668_compare_arrays_silviucpp: [ OK ] 0.83 sec.
2025-06-04 01:01:58 00506_union_distributed: [ OK ] 1.74 sec.
2025-06-04 01:01:58 02286_tuple_numeric_identifier: [ OK ] 1.74 sec.
2025-06-04 01:01:58 02572_max_intersections: [ OK ] 0.68 sec.
2025-06-04 01:01:58 03207_json_read_subcolumns_2_wide_merge_tree: [ SKIPPED ] 0.00 sec.
2025-06-04 01:01:58 Reason: not running for current build
2025-06-04 01:01:59 02715_or_null: [ OK ] 0.79 sec.
2025-06-04 01:01:59 01817_storage_buffer_parameters: [ OK ] 1.14 sec.
2025-06-04 01:02:00 01063_create_column_set: [ OK ] 0.78 sec.
2025-06-04 01:02:00 01785_pmj_lc_bug: [ OK ] 1.04 sec.
2025-06-04 01:02:01 03162_dynamic_type_nested: [ OK ] 0.89 sec.
2025-06-04 01:02:01 02008_test_union_distinct_in_subquery: [ OK ] 1.38 sec.
2025-06-04 01:02:02 01527_bad_aggregation_in_lambda: [ OK ] 0.98 sec.
2025-06-04 01:02:02 02149_schema_inference_create_table_syntax: [ OK ] 15.04 sec.
2025-06-04 01:02:03 02013_json_function_null_column: [ OK ] 4.15 sec.
2025-06-04 01:02:03 01054_random_printable_ascii_ubsan: [ OK ] 6.14 sec.
2025-06-04 01:02:03 00492_drop_temporary_table: [ OK ] 0.88 sec.
2025-06-04 01:02:03 02661_read_from_archive_tzst: [ OK ] 40.20 sec.
2025-06-04 01:02:04 01102_distributed_local_in_bug: [ OK ] 1.04 sec.
2025-06-04 01:02:04 03227_dynamic_subcolumns_enumerate_streams: [ OK ] 0.83 sec.
2025-06-04 01:02:04 03151_external_cross_join: [ OK ] 7.55 sec.
2025-06-04 01:02:05 03173_check_cyclic_dependencies_on_create_and_rename: [ OK ] 2.28 sec.
2025-06-04 01:02:05 02020_cast_integer_overflow: [ OK ] 0.73 sec.
2025-06-04 01:02:05 01305_polygons_union: [ OK ] 1.99 sec.
2025-06-04 01:02:05 01869_reinterpret_as_fixed_string_uuid: [ OK ] 0.69 sec.
2025-06-04 01:02:05 01017_bithamming_distance: [ OK ] 1.19 sec.
2025-06-04 01:02:06 01788_update_nested_type_subcolumn_check: [ OK ] 2.94 sec.
2025-06-04 01:02:06 00468_array_join_multiple_arrays_and_use_original_column: [ OK ] 0.95 sec.
2025-06-04 01:02:06 02242_optimize_to_subcolumns_no_storage: [ OK ] 0.79 sec.
2025-06-04 01:02:07 02915_fpc_overflow: [ OK ] 2.24 sec.
2025-06-04 01:02:07 01674_clickhouse_client_query_param_cte: [ OK ] 2.19 sec.
2025-06-04 01:02:07 02426_orc_bug: [ OK ] 2.13 sec.
2025-06-04 01:02:07 02868_select_support_from_keywords: [ OK ] 0.73 sec.
2025-06-04 01:02:08 01683_intdiv_ubsan: [ OK ] 1.59 sec.
2025-06-04 01:02:09 01318_map_populate_series: [ OK ] 2.79 sec.
2025-06-04 01:02:10 02001_append_output_file: [ OK ] 2.85 sec.
2025-06-04 01:02:10 02158_proportions_ztest_cmp: [ OK ] 2.64 sec.
2025-06-04 01:02:10 03041_analyzer_gigachad_join: [ OK ] 1.03 sec.
2025-06-04 01:02:11 01948_group_bitmap_and_or_xor_fix: [ OK ] 0.74 sec.
2025-06-04 01:02:11 02302_projections_GROUP_BY_ORDERY_BY_optimize_aggregation_in_order: [ OK ] 0.98 sec.
2025-06-04 01:02:11 01787_arena_assert_column_nothing: [ OK ] 0.80 sec.
2025-06-04 01:02:12 00003_reinterpret_as_string: [ OK ] 0.63 sec.
2025-06-04 01:02:12 01091_insert_with_default_json: [ OK ] 0.94 sec.
2025-06-04 01:02:13 02291_dictionary_scalar_subquery_reload: [ OK ] 1.08 sec.
2025-06-04 01:02:13 02995_forget_partition: [ OK ] 12.02 sec.
2025-06-04 01:02:14 02711_trim_aliases: [ OK ] 0.79 sec.
2025-06-04 01:02:14 02205_postgresql_functions: [ OK ] 2.44 sec.
2025-06-04 01:02:15 02980_s3_plain_DROP_TABLE_ReplicatedMergeTree: [ OK ] 6.95 sec.
2025-06-04 01:02:15 01906_partition_by_multiply_by_zero: [ OK ] 0.79 sec.
2025-06-04 01:02:16 03008_filter_projections_non_deterministoc_functions: [ OK ] 2.54 sec.
2025-06-04 01:02:16 01837_cast_to_array_from_empty_array: [ OK ] 0.74 sec.
2025-06-04 01:02:16 03019_numbers_pretty: [ OK ] 0.85 sec.
2025-06-04 01:02:17 01938_joins_identifiers: [ OK ] 0.94 sec.
2025-06-04 01:02:17 01648_mutations_and_escaping: [ OK ] 5.90 sec.
2025-06-04 01:02:17 00402_nan_and_extremes: [ OK ] 0.93 sec.
2025-06-04 01:02:17 00814_parsing_ub: [ OK ] 0.74 sec.
2025-06-04 01:02:17 02566_analyzer_limit_settings_distributed: [ OK ] 1.28 sec.
2025-06-04 01:02:19 00700_decimal_in_keys: [ OK ] 1.44 sec.
2025-06-04 01:02:20 01514_empty_buffer_different_types: [ OK ] 0.93 sec.
2025-06-04 01:02:21 02347_rank_corr_nan: [ OK ] 0.90 sec.
2025-06-04 01:02:23 02454_disable_mergetree_with_lightweight_delete_column: [ OK ] 2.36 sec.
2025-06-04 01:02:24 03157_dynamic_type_json: [ OK ] 0.93 sec.
2025-06-04 01:02:25 02764_index_analysis_fix: [ OK ] 0.83 sec.
2025-06-04 01:02:26 01913_names_of_tuple_literal: [ OK ] 0.73 sec.
2025-06-04 01:02:28 01079_order_by_pk: [ OK ] 11.01 sec.
2025-06-04 01:02:28 02516_projections_with_rollup: [ OK ] 11.01 sec.
2025-06-04 01:02:29 02507_to_unix_timestamp_overflow: [ OK ] 1.44 sec.
2025-06-04 01:02:30 00637_sessions_in_http_interface_and_settings: [ OK ] 1.59 sec.
2025-06-04 01:02:30 01281_sum_nullable: [ OK ] 0.94 sec.
2025-06-04 01:02:31 02474_fix_function_parser_bug: [ OK ] 0.54 sec.
2025-06-04 01:02:32 00779_all_right_join_max_block_size: [ OK ] 0.79 sec.
2025-06-04 01:02:32 02162_array_first_last_index: [ OK ] 1.14 sec.
2025-06-04 01:02:40 02003_memory_limit_in_client: [ OK ] 14.48 sec.
2025-06-04 01:02:42 00996_neighbor: [ OK ] 1.49 sec.
2025-06-04 01:02:43 01804_uniq_up_to_ubsan: [ OK ] 1.24 sec.
2025-06-04 01:02:45 03033_dist_settings.optimize_skip_unused_shards_rewrite_in_composite_sharding_key: [ OK ] 1.45 sec.
2025-06-04 01:02:46 01926_order_by_desc_limit: [ OK ] 13.98 sec.
2025-06-04 01:02:47 00143_number_classification_functions: [ OK ] 1.24 sec.
2025-06-04 01:02:48 01338_long_select_and_alter_zookeeper: [ OK ] 16.68 sec.
2025-06-04 01:02:49 01220_scalar_optimization_in_alter: [ OK ] 0.73 sec.
2025-06-04 01:02:50 00446_clear_column_in_partition_concurrent_zookeeper: [ OK ] 36.13 sec.
2025-06-04 01:02:51 02126_url_auth: [ OK ] 2.09 sec.
2025-06-04 01:02:52 00952_part_frozen_info: [ OK ] 1.18 sec.
2025-06-04 01:02:52 02421_new_type_json_async_insert: [ OK ] 7.10 sec.
2025-06-04 01:02:52 02163_operators: [ OK ] 0.78 sec.
2025-06-04 01:02:53 02442_auxiliary_zookeeper_endpoint_id: [ OK ] 1.34 sec.
2025-06-04 01:02:53 02969_auto_format_detection: [ OK ] 36.62 sec.
2025-06-04 01:02:54 02907_clickhouse_dictionary_bug: [ OK ] 2.34 sec.
2025-06-04 01:02:54 02999_ulid_short_circuit: [ OK ] 0.74 sec.
2025-06-04 01:02:54 02784_projections_read_in_order_bug: [ OK ] 1.04 sec.
2025-06-04 01:02:54 01902_table_function_merge_db_params: [ OK ] 1.93 sec.
2025-06-04 01:02:55 00647_select_numbers_with_offset: [ OK ] 0.73 sec.
2025-06-04 01:02:56 02311_hashed_array_dictionary_hierarchical_functions: [ OK ] 1.43 sec.
2025-06-04 01:02:59 02922_respect_nulls_extensive: [ OK ] 3.00 sec.
2025-06-04 01:03:01 03212_thousand_exceptions: [ OK ] 53.77 sec.
2025-06-04 01:03:01 02122_parallel_formatting_JSONCompact: [ OK ] 6.85 sec.
2025-06-04 01:03:02 00004_shard_format_ast_and_remote_table: [ OK ] 0.79 sec.
2025-06-04 01:03:02 03113_analyzer_not_found_column_in_block_2: [ OK ] 0.98 sec.
2025-06-04 01:03:03 02841_join_filter_set_sparse: [ OK ] 1.34 sec.
2025-06-04 01:03:05 00623_truncate_table: [ OK ] 2.04 sec.
2025-06-04 01:03:06 01508_format_regexp_raw: [ OK ] 3.34 sec.
2025-06-04 01:03:06 01592_toUnixTimestamp_Date: [ OK ] 0.78 sec.
2025-06-04 01:03:07 02095_function_get_os_kernel_version: [ OK ] 0.74 sec.
2025-06-04 01:03:09 03105_table_aliases_in_mv: [ OK ] 1.20 sec.
2025-06-04 01:03:10 02932_parallel_replicas_fuzzer: [ OK ] 1.14 sec.
2025-06-04 01:03:11 00752_low_cardinality_array_result: [ OK ] 0.79 sec.
2025-06-04 01:03:11 00937_test_use_header_csv: [ OK ] 11.66 sec.
2025-06-04 01:03:12 01910_view_dictionary_check_refresh: [ OK ] 25.35 sec.
2025-06-04 01:03:13 01202_array_auc_special: [ OK ] 2.34 sec.
2025-06-04 01:03:14 02554_format_json_columns_for_empty: [ OK ] 0.78 sec.
2025-06-04 01:03:15 02809_has_subsequence: [ OK ] 2.31 sec.
2025-06-04 01:03:15 00839_bitmask_negative: [ OK ] 1.08 sec.
2025-06-04 01:03:16 01700_system_zookeeper_path_in: [ OK ] 1.30 sec.
2025-06-04 01:03:17 02176_optimize_aggregation_in_order_empty: [ OK ] 0.88 sec.
2025-06-04 01:03:19 03002_filter_skip_virtual_columns_with_non_deterministic_functions: [ OK ] 13.27 sec.
2025-06-04 01:03:19 03093_special_column_errors: [ OK ] 8.15 sec.
2025-06-04 01:03:20 00552_or_nullable: [ OK ] 1.08 sec.
2025-06-04 01:03:20 03038_recursive_cte_postgres_4: [ OK ] 1.28 sec.
2025-06-04 01:03:21 01058_zlib_ng_level1_bug: [ OK ] 6.10 sec.
2025-06-04 01:03:21 01381_for_each_with_states: [ OK ] 0.99 sec.
2025-06-04 01:03:22 01849_geoToS2: [ OK ] 4.65 sec.
2025-06-04 01:03:22 03015_with_fill_invalid_expression: [ OK ] 1.03 sec.
2025-06-04 01:03:22 02513_prewhere_combine_step_filters: [ OK ] 2.24 sec.
2025-06-04 01:03:23 02908_filesystem_cache_as_collection: [ OK ] 0.89 sec.
2025-06-04 01:03:24 02661_read_from_archive_zip: [ OK ] 28.51 sec.
2025-06-04 01:03:24 00275_shard_quantiles_weighted: [ OK ] 1.89 sec.
2025-06-04 01:03:25 00066_group_by_in: [ OK ] 0.80 sec.
2025-06-04 01:03:25 01451_wrong_error_long_query: [ OK ] 1.84 sec.
2025-06-04 01:03:25 03131_deprecated_functions: [ OK ] 2.79 sec.
2025-06-04 01:03:26 02266_auto_add_nullable: [ OK ] 0.78 sec.
2025-06-04 01:03:26 01770_extended_range_3: [ OK ] 0.94 sec.
2025-06-04 01:03:26 02311_create_table_with_unknown_format: [ OK ] 2.59 sec.
2025-06-04 01:03:27 01442_merge_detach_attach_long: [ OK ] 33.17 sec.
2025-06-04 01:03:27 01520_client_print_query_id: [ OK ] 2.19 sec.
2025-06-04 01:03:27 00465_nullable_default: [ OK ] 0.79 sec.
2025-06-04 01:03:28 01440_big_int_shift: [ OK ] 0.84 sec.
2025-06-04 01:03:28 02949_parallel_replicas_in_subquery: [ OK ] 2.14 sec.
2025-06-04 01:03:28 02324_map_combinator_bug: [ OK ] 1.19 sec.
2025-06-04 01:03:28 02999_scalar_subqueries_bug_1: [ OK ] 1.13 sec.
2025-06-04 01:03:29 01498_alter_column_storage_memory: [ OK ] 0.88 sec.
2025-06-04 01:03:29 02096_bad_options_in_client_and_local: [ OK ] 3.20 sec.
2025-06-04 01:03:30 02236_json_each_row_empty_map_schema_inference: [ OK ] 0.74 sec.
2025-06-04 01:03:30 00080_show_tables_and_system_tables: [ OK ] 1.13 sec.
2025-06-04 01:03:31 00161_rounding_functions: [ OK ] 3.04 sec.
2025-06-04 01:03:31 01458_count_digits: [ OK ] 1.04 sec.
2025-06-04 01:03:32 02500_analyzer_storage_view_crash_fix: [ OK ] 0.98 sec.
2025-06-04 01:03:32 00842_array_with_constant_overflow: [ OK ] 1.33 sec.
2025-06-04 01:03:33 01891_partition_by_uuid: [ OK ] 0.73 sec.
2025-06-04 01:03:33 01710_query_log_with_projection_info: [ OK ] 2.68 sec.
2025-06-04 01:03:33 03036_dynamic_read_subcolumns_memory: [ SKIPPED ] 0.00 sec.
2025-06-04 01:03:33 Reason: not running for current build
2025-06-04 01:03:33 01626_cnf_test: [ OK ] 1.13 sec.
2025-06-04 01:03:34 01838_system_dictionaries_virtual_key_column: [ OK ] 0.99 sec.
2025-06-04 01:03:34 03148_async_queries_in_query_log_errors: [ OK ] 5.75 sec.
2025-06-04 01:03:35 01045_bloom_filter_null_array: [ OK ] 1.14 sec.
2025-06-04 01:03:36 00725_memory_tracking: [ OK ] 1.84 sec.
2025-06-04 01:03:36 01084_regexp_empty: [ OK ] 0.75 sec.
2025-06-04 01:03:37 02125_lz4_compression_bug_Values: [ OK ] 15.68 sec.
2025-06-04 01:03:37 01073_crlf_end_of_line: [ OK ] 0.83 sec.
2025-06-04 01:03:37 00661_optimize_final_replicated_without_partition_zookeeper: [ OK ] 1.65 sec.
2025-06-04 01:03:38 02981_vertical_merges_memory_usage: [ OK ] 9.21 sec.
2025-06-04 01:03:38 01230_join_get_truncate: [ OK ] 0.98 sec.
2025-06-04 01:03:39 03126_column_not_under_group_by: [ OK ] 1.04 sec.
2025-06-04 01:03:39 00860_unknown_identifier_bug: [ OK ] 0.88 sec.
2025-06-04 01:03:39 02267_file_globs_schema_inference: [ OK ] 6.45 sec.
2025-06-04 01:03:40 02499_analyzer_set_index: [ OK ] 0.98 sec.
2025-06-04 01:03:40 02221_system_zookeeper_unrestricted_like: [ OK ] 7.10 sec.
2025-06-04 01:03:41 02723_param_exception_message_context: [ OK ] 2.49 sec.
2025-06-04 01:03:42 02999_analyzer_preimage_null: [ OK ] 0.88 sec.
2025-06-04 01:03:42 02481_async_insert_dedup: [ OK ] 96.58 sec.
2025-06-04 01:03:42 01710_projection_optimize_group_by_function_keys: [ OK ] 1.99 sec.
2025-06-04 01:03:43 01273_arrow_nested_arrays_load: [ OK ] 5.79 sec.
2025-06-04 01:03:43 00800_function_java_hash: [ OK ] 1.11 sec.
2025-06-04 01:03:44 02480_analyzer_alias_nullptr: [ OK ] 1.23 sec.
2025-06-04 01:03:44 02556_local_with_totals_and_extremes: [ OK ] 2.05 sec.
2025-06-04 01:03:44 02943_variant_element: [ OK ] 1.19 sec.
2025-06-04 01:03:45 02923_join_use_nulls_modulo: [ OK ] 0.78 sec.
2025-06-04 01:03:45 00823_sequence_match_dfa: [ OK ] 2.99 sec.
2025-06-04 01:03:45 01144_multiword_data_types: [ OK ] 0.88 sec.
2025-06-04 01:03:46 00834_not_between: [ OK ] 0.83 sec.
2025-06-04 01:03:47 02815_range_dict_no_direct_join: [ OK ] 1.09 sec.
2025-06-04 01:03:47 02276_full_sort_join_unsupported: [ OK ] 2.64 sec.
2025-06-04 01:03:47 01499_log_deadlock: [ OK ] 1.09 sec.
2025-06-04 01:03:47 03212_max_bytes_to_read_for_schema_inference_in_cache: [ OK ] 2.03 sec.
2025-06-04 01:03:47 03167_base64_url_functions_sh: [ OK ] 128.06 sec.
2025-06-04 01:03:48 01508_explain_header: [ OK ] 0.73 sec.
2025-06-04 01:03:48 01851_s2_to_geo: [ OK ] 0.73 sec.
2025-06-04 01:03:48 01323_if_with_nulls: [ OK ] 1.73 sec.
2025-06-04 01:03:48 02543_alter_update_rename_stuck: [ OK ] 9.06 sec.
2025-06-04 01:03:48 01170_alter_partition_isolation: [ OK ] 9.90 sec.
2025-06-04 01:03:49 02003_WithMergeableStateAfterAggregationAndLimit_LIMIT_BY_LIMIT_OFFSET: [ OK ] 1.18 sec.
2025-06-04 01:03:49 01942_untuple_transformers_msan: [ OK ] 0.68 sec.
2025-06-04 01:03:49 02560_count_digits: [ OK ] 1.19 sec.
2025-06-04 01:03:49 02011_tuple_vector_functions: [ OK ] 9.75 sec.
2025-06-04 01:03:50 00975_sample_prewhere_distributed: [ OK ] 1.13 sec.
2025-06-04 01:03:50 02922_server_exit_code: [ OK ] 2.79 sec.
2025-06-04 01:03:50 03013_position_const_start_pos: [ OK ] 0.78 sec.
2025-06-04 01:03:50 00650_array_enumerate_uniq_with_tuples: [ OK ] 1.24 sec.
2025-06-04 01:03:50 02316_cast_to_ip_address_default_column: [ OK ] 0.98 sec.
2025-06-04 01:03:50 00712_nan_comparison: [ OK ] 1.65 sec.
2025-06-04 01:03:50 02533_generate_random_schema_inference: [ OK ] 0.78 sec.
2025-06-04 01:03:51 02049_lowcardinality_shortcircuit_crash: [ OK ] 0.94 sec.
2025-06-04 01:03:51 02701_invalid_having_NOT_AN_AGGREGATE: [ OK ] 0.93 sec.
2025-06-04 01:03:51 01825_new_type_json_parallel_insert: [ OK ] 1.59 sec.
2025-06-04 01:03:52 03166_optimize_row_order_during_insert: [ OK ] 1.44 sec.
2025-06-04 01:03:52 02246_flatten_tuple: [ OK ] 1.03 sec.
2025-06-04 01:03:52 01690_quantilesTiming_ubsan: [ OK ] 0.73 sec.
2025-06-04 01:03:53 02868_operator_is_not_distinct_from_priority: [ OK ] 0.88 sec.
2025-06-04 01:03:53 01670_distributed_bytes_to_throw_insert: [ OK ] 1.49 sec.
2025-06-04 01:03:54 01072_optimize_skip_unused_shards_const_expr_eval: [ OK ] 3.24 sec.
2025-06-04 01:03:54 00585_union_all_subquery_aggregation_column_removal: [ OK ] 1.69 sec.
2025-06-04 01:03:55 01944_insert_partition_by: [ OK ] 4.64 sec.
2025-06-04 01:03:55 01014_format_custom_separated: [ OK ] 8.10 sec.
2025-06-04 01:03:55 03006_buffer_overflow_join: [ OK ] 0.88 sec.
2025-06-04 01:03:55 00999_test_skip_indices_with_alter_and_merge: [ OK ] 0.95 sec.
2025-06-04 01:03:55 00662_array_has_nullable: [ OK ] 2.24 sec.
2025-06-04 01:03:56 01532_tuple_with_name_type: [ OK ] 0.84 sec.
2025-06-04 01:03:56 02751_multiif_to_if_crash: [ OK ] 0.75 sec.
2025-06-04 01:03:56 00623_replicated_truncate_table_zookeeper_long: [ OK ] 1.59 sec.
2025-06-04 01:03:57 02898_parallel_replicas_custom_key_final: [ OK ] 1.21 sec.
2025-06-04 01:03:57 03001_block_offset_column_2: [ OK ] 1.23 sec.
2025-06-04 01:03:58 02454_set_parameters_formatting: [ OK ] 1.69 sec.
2025-06-04 01:03:59 02584_compressor_codecs: [ OK ] 2.80 sec.
2025-06-04 01:04:00 02472_segfault_expression_parser: [ OK ] 0.64 sec.
2025-06-04 01:04:00 01559_misplaced_codec_diagnostics: [ OK ] 0.55 sec.
2025-06-04 01:04:01 01430_modify_sample_by_zookeeper_long: [ OK ] 4.74 sec.
2025-06-04 01:04:01 03154_recursive_cte_distributed: [ OK ] 2.56 sec.
2025-06-04 01:04:01 00098_j_union_all: [ OK ] 0.80 sec.
2025-06-04 01:04:02 01825_new_type_json_bools: [ OK ] 0.84 sec.
2025-06-04 01:04:02 02444_async_broken_outdated_part_loading: [ OK ] 11.96 sec.
2025-06-04 01:04:03 03246_json_tuple_decompress_race: [ OK ] 2.19 sec.
2025-06-04 01:04:03 01710_projection_with_nullable_keys: [ OK ] 0.89 sec.
2025-06-04 01:04:04 02012_compress_lz4: [ OK ] 2.94 sec.
2025-06-04 01:04:05 02245_s3_virtual_columns: [ OK ] 1.29 sec.
2025-06-04 01:04:06 02418_keeper_map_keys_limit: [ OK ] 2.44 sec.
2025-06-04 01:04:06 00296_url_parameters: [ OK ] 1.29 sec.
2025-06-04 01:04:07 01926_union_all_schmak: [ OK ] 0.79 sec.
2025-06-04 01:04:07 02789_functions_after_sorting_and_columns_with_same_names_bug: [ OK ] 1.39 sec.
2025-06-04 01:04:07 01103_check_cpu_instructions_at_startup: [ SKIPPED ] 0.00 sec.
2025-06-04 01:04:07 Reason: not running for current build
2025-06-04 01:04:07 00953_indices_alter_exceptions: [ OK ] 5.22 sec.
2025-06-04 01:04:09 00841_temporary_table_database: [ OK ] 1.33 sec.
2025-06-04 01:04:09 03085_analyzer_alias_column_group_by: [ OK ] 0.73 sec.
2025-06-04 01:04:11 02122_parallel_formatting_Values: [ OK ] 6.52 sec.
2025-06-04 01:04:11 03161_decimal_binary_math: [ OK ] 3.53 sec.
2025-06-04 01:04:12 01455_nullable_type_with_if_agg_combinator: [ OK ] 0.89 sec.
2025-06-04 01:04:12 02421_simple_queries_for_opentelemetry: [ OK ] 15.63 sec.
2025-06-04 01:04:13 02790_url_multiple_tsv_files: [ OK ] 5.75 sec.
2025-06-04 01:04:14 01652_ttl_old_syntax: [ OK ] 1.18 sec.
2025-06-04 01:04:14 02122_4letter_words_stress_zookeeper: [ OK ] 22.36 sec.
2025-06-04 01:04:15 00619_union_highlite: [ OK ] 0.94 sec.
2025-06-04 01:04:16 02227_union_match_by_name: [ OK ] 0.79 sec.
2025-06-04 01:04:17 01548_uncomparable_columns_in_keys: [ OK ] 1.54 sec.
2025-06-04 01:04:19 00825_protobuf_format_skipped_column_in_nested: [ OK ] 4.95 sec.
2025-06-04 01:04:20 01576_if_null_external_aggregation: [ OK ] 7.85 sec.
2025-06-04 01:04:21 03207_composite_expressions_lambda_consistent_formatting: [ OK ] 1.79 sec.
2025-06-04 01:04:22 01511_alter_version_versioned_collapsing_merge_tree: [ OK ] 2.24 sec.
2025-06-04 01:04:22 02271_replace_partition_many_tables: [ OK ] 31.86 sec.
2025-06-04 01:04:23 00975_recursive_materialized_view: [ OK ] 1.24 sec.
2025-06-04 01:04:23 02275_full_sort_join_long: [ SKIPPED ] 0.00 sec.
2025-06-04 01:04:23 Reason: not running for current build
2025-06-04 01:04:24 00700_decimal_casts: [ OK ] 11.32 sec.
2025-06-04 01:04:24 00820_multiple_joins_subquery_requires_alias: [ OK ] 1.89 sec.
2025-06-04 01:04:24 00700_to_decimal_or_something: [ OK ] 7.05 sec.
2025-06-04 01:04:25 01914_ubsan_quantile_timing: [ OK ] 0.73 sec.
2025-06-04 01:04:25 02881_system_detached_parts_modification_time: [ OK ] 1.18 sec.
2025-06-04 01:04:26 03039_recursive_cte_postgres_5: [ OK ] 2.04 sec.
2025-06-04 01:04:26 02843_backup_use_same_s3_credentials_for_base_backup: [ OK ] 15.12 sec.
2025-06-04 01:04:26 02457_filesystem_function: [ OK ] 1.65 sec.
2025-06-04 01:04:27 03146_bug47862: [ OK ] 0.84 sec.
2025-06-04 01:04:27 00590_limit_by_column_removal: [ OK ] 0.94 sec.
2025-06-04 01:04:28 00157_aliases_and_lambda_formal_parameters: [ OK ] 0.74 sec.
2025-06-04 01:04:28 00688_low_cardinality_defaults: [ OK ] 0.90 sec.
2025-06-04 01:04:28 02426_to_string_nullable_fixedstring: [ OK ] 0.78 sec.
2025-06-04 01:04:29 03263_analyzer_materialized_view_cte_nested: [ OK ] 1.24 sec.
2025-06-04 01:04:30 00148_summing_merge_tree_aggregate_function: [ OK ] 8.76 sec.
2025-06-04 01:04:31 01234_to_string_monotonic: [ OK ] 2.44 sec.
2025-06-04 01:04:32 02179_range_hashed_dictionary_invalid_interval: [ OK ] 1.21 sec.
2025-06-04 01:04:32 02718_parquet_metadata_format: [ OK ] 7.61 sec.
2025-06-04 01:04:32 00195_shard_union_all_and_global_in: [ OK ] 1.24 sec.
2025-06-04 01:04:33 01080_window_view_inner_table_memory_hop: [ OK ] 6.61 sec.
2025-06-04 01:04:34 02941_variant_type_2: [ OK ] 37.17 sec.
2025-06-04 01:04:36 02802_clickhouse_disks_s3_copy: [ OK ] 3.54 sec.
2025-06-04 01:04:38 01272_suspicious_codecs: [ OK ] 4.85 sec.
2025-06-04 01:04:38 03211_nested_json_merges: [ SKIPPED ] 0.00 sec.
2025-06-04 01:04:38 Reason: not running for current build
2025-06-04 01:04:39 02751_text_formats_bad_nullable_parsing: [ OK ] 6.56 sec.
2025-06-04 01:04:39 02496_remove_redundant_sorting_analyzer: [ OK ] 29.56 sec.
2025-06-04 01:04:39 01553_datetime64_comparison: [ OK ] 0.74 sec.
2025-06-04 01:04:39 02151_client_option_echo: [ OK ] 3.69 sec.
2025-06-04 01:04:40 00581_limit_on_result_and_subquery_and_insert: [ OK ] 0.84 sec.
2025-06-04 01:04:40 01214_point_in_Mecca: [ OK ] 8.66 sec.
2025-06-04 01:04:42 02572_query_views_log_background_thread: [ OK ] 17.09 sec.
2025-06-04 01:04:42 00847_multiple_join_same_column: [ OK ] 1.59 sec.
2025-06-04 01:04:42 01670_test_repeat_mysql_dialect: [ OK ] 0.73 sec.
2025-06-04 01:04:43 00322_disable_checksumming: [ OK ] 1.49 sec.
2025-06-04 01:04:44 01790_dist_INSERT_block_structure_mismatch_types_and_names: [ OK ] 1.13 sec.
2025-06-04 01:04:44 00618_nullable_in: [ OK ] 0.78 sec.
2025-06-04 01:04:45 01496_signedness_conversion_monotonicity: [ OK ] 0.88 sec.
2025-06-04 01:04:45 02245_make_datetime64: [ OK ] 6.45 sec.
2025-06-04 01:04:45 01521_max_length_alias: [ OK ] 0.98 sec.
2025-06-04 01:04:46 00365_statistics_in_formats: [ OK ] 6.11 sec.
2025-06-04 01:04:46 01640_distributed_async_insert_compression: [ OK ] 1.04 sec.
2025-06-04 01:04:46 02473_extract_low_cardinality_from_json: [ OK ] 0.88 sec.
2025-06-04 01:04:47 02540_analyzer_matcher_alias_materialized_columns: [ OK ] 1.13 sec.
2025-06-04 01:04:47 01083_window_view_select: [ OK ] 6.81 sec.
2025-06-04 01:04:47 03024_total_rows_approx_is_set_for_system_zeros_and_generate_random: [ OK ] 1.84 sec.
2025-06-04 01:04:49 02366_asof_optimize_predicate_bug_37813: [ OK ] 1.08 sec.
2025-06-04 01:04:50 00757_enum_defaults_const: [ OK ] 0.89 sec.
2025-06-04 01:04:50 02024_compile_expressions_with_short_circuit_evaluation: [ OK ] 0.81 sec.
2025-06-04 01:04:51 01461_query_start_time_microseconds: [ OK ] 4.54 sec.
2025-06-04 01:04:52 01031_mutations_interpreter_and_context: [ OK ] 6.00 sec.
2025-06-04 01:04:53 01661_week_functions_string_args: [ OK ] 5.95 sec.
2025-06-04 01:04:53 01412_row_from_totals: [ OK ] 1.38 sec.
2025-06-04 01:04:54 00609_distributed_with_case_when_then: [ OK ] 1.24 sec.
2025-06-04 01:04:55 02498_random_string_in_json_schema_inference: [ OK ] 2.09 sec.
2025-06-04 01:04:55 00732_quorum_insert_simple_test_1_parts_zookeeper_long: [ OK ] 2.24 sec.
2025-06-04 01:04:55 01509_parallel_quorum_and_merge_long: [ OK ] 16.15 sec.
2025-06-04 01:04:56 00926_adaptive_index_granularity_collapsing_merge_tree: [ OK ] 1.99 sec.
2025-06-04 01:04:56 03303_alias_inverse_order: [ OK ] 0.89 sec.
2025-06-04 01:04:57 01009_insert_select_data_loss: [ OK ] 1.09 sec.
2025-06-04 01:04:57 00760_insert_json_with_defaults: [ OK ] 1.70 sec.
2025-06-04 01:04:59 01084_defaults_on_aliases: [ OK ] 1.99 sec.
2025-06-04 01:05:01 00450_higher_order_and_nullable: [ OK ] 1.37 sec.
2025-06-04 01:05:02 02016_aggregation_spark_bar: [ OK ] 6.69 sec.
2025-06-04 01:05:02 01431_utf8_ubsan: [ OK ] 1.23 sec.
2025-06-04 01:05:04 01088_array_slice_of_aggregate_functions: [ OK ] 1.26 sec.
2025-06-04 01:05:05 01605_skip_idx_compact_parts: [ OK ] 2.52 sec.
2025-06-04 01:05:06 02426_pod_array_overflow_2: [ OK ] 1.78 sec.
2025-06-04 01:05:07 02883_zookeeper_finalize_stress: [ OK ] 10.08 sec.
2025-06-04 01:05:08 02134_async_inserts_formats: [ OK ] 10.82 sec.
2025-06-04 01:05:09 01670_log_comment: [ OK ] 2.60 sec.
2025-06-04 01:05:09 00835_if_generic_case: [ OK ] 2.30 sec.
2025-06-04 01:05:09 02993_lazy_index_loading: [ OK ] 18.46 sec.
2025-06-04 01:05:10 00059_shard_global_in_mergetree: [ OK ] 2.16 sec.
2025-06-04 01:05:10 01825_type_json_ghdata_insert_select: [ OK ] 37.10 sec.
2025-06-04 01:05:10 01093_cyclic_defaults_filimonov: [ OK ] 1.64 sec.
2025-06-04 01:05:11 02995_preliminary_filters_duplicated_columns: [ OK ] 0.99 sec.
2025-06-04 01:05:11 02049_clickhouse_local_merge_tree: [ OK ] 2.39 sec.
2025-06-04 01:05:12 03205_json_cast_from_string: [ OK ] 1.49 sec.
2025-06-04 01:05:12 01045_array_zip: [ OK ] 2.89 sec.
2025-06-04 01:05:13 02911_analyzer_explain_estimate: [ OK ] 0.89 sec.
2025-06-04 01:05:13 02165_h3_num_hexagons: [ OK ] 1.90 sec.
2025-06-04 01:05:13 02346_read_in_order_fixed_prefix: [ OK ] 43.85 sec.
2025-06-04 01:05:13 00299_stripe_log_multiple_inserts: [ OK ] 1.94 sec.
2025-06-04 01:05:13 02915_input_table_function_in_subquery: [ OK ] 3.25 sec.
2025-06-04 01:05:14 03041_select_with_query_result: [ OK ] 1.09 sec.
2025-06-04 01:05:14 01040_h3_get_resolution: [ OK ] 0.78 sec.
2025-06-04 01:05:15 00940_max_parts_in_total: [ OK ] 1.49 sec.
2025-06-04 01:05:15 01018_ddl_dictionaries_special: [ OK ] 2.10 sec.
2025-06-04 01:05:15 00471_sql_style_quoting: [ OK ] 0.74 sec.
2025-06-04 01:05:15 02267_join_dup_columns_issue36199: [ OK ] 2.05 sec.
2025-06-04 01:05:15 00556_array_intersect: [ OK ] 1.09 sec.
2025-06-04 01:05:16 01650_expressions_merge_bug: [ OK ] 0.73 sec.
2025-06-04 01:05:16 01247_least_greatest_filimonov: [ OK ] 0.83 sec.
2025-06-04 01:05:16 03203_multiif_and_where_2_conditions_old_analyzer_bug: [ OK ] 1.29 sec.
2025-06-04 01:05:16 00652_replicated_mutations_default_database_zookeeper: [ OK ] 4.65 sec.
2025-06-04 01:05:16 00236_replicated_drop_on_non_leader_zookeeper_long: [ OK ] 1.29 sec.
2025-06-04 01:05:17 02967_fuzz_bad_cast: [ OK ] 1.05 sec.
2025-06-04 01:05:17 02844_max_backup_bandwidth_s3: [ OK ] 31.77 sec.
2025-06-04 01:05:17 01107_join_right_table_totals: [ OK ] 2.19 sec.
2025-06-04 01:05:18 03001_data_version_column: [ OK ] 1.24 sec.
2025-06-04 01:05:18 02971_functions_to_subcolumns_variant: [ OK ] 0.84 sec.
2025-06-04 01:05:18 03093_bug_gcd_codec: [ OK ] 1.39 sec.
2025-06-04 01:05:19 02806_cte_block_cannot_be_empty: [ OK ] 0.94 sec.
2025-06-04 01:05:19 03168_fuzz_multiIf_short_circuit: [ OK ] 0.79 sec.
2025-06-04 01:05:20 01825_type_json_mutations: [ OK ] 1.34 sec.
2025-06-04 01:05:20 02325_compatibility_setting_2: [ OK ] 1.19 sec.
2025-06-04 01:05:22 02097_polygon_dictionary_store_key: [ OK ] 1.50 sec.
2025-06-04 01:05:22 01436_storage_merge_with_join_push_down: [ OK ] 1.30 sec.
2025-06-04 01:05:22 02859_replicated_db_name_zookeeper: [ OK ] 5.71 sec.
2025-06-04 01:05:22 02995_index_6: [ SKIPPED ] 0.00 sec.
2025-06-04 01:05:22 Reason: not running for current build
2025-06-04 01:05:22 00757_enum_defaults_const_analyzer: [ OK ] 0.85 sec.
2025-06-04 01:05:23 01273_arrow_load: [ OK ] 4.45 sec.
2025-06-04 01:05:24 00619_extract: [ OK ] 1.24 sec.
2025-06-04 01:05:24 00379_system_processes_port: [ OK ] 1.49 sec.
2025-06-04 01:05:25 02517_infer_uint64_in_case_of_int64_overflow: [ OK ] 8.61 sec.
2025-06-04 01:05:25 00437_nulls_first_last: [ OK ] 2.70 sec.
2025-06-04 01:05:25 02579_parameterized_replace: [ OK ] 0.78 sec.
2025-06-04 01:05:26 02874_toDaysSinceYearZero: [ OK ] 3.64 sec.
2025-06-04 01:05:26 02680_illegal_type_of_filter_projection: [ OK ] 1.45 sec.
2025-06-04 01:05:26 02212_h3_get_pentagon_indexes: [ OK ] 1.99 sec.
2025-06-04 01:05:26 02477_logical_expressions_optimizer_low_cardinality: [ OK ] 1.15 sec.
2025-06-04 01:05:26 02676_kafka_murmur_hash: [ OK ] 0.80 sec.
2025-06-04 01:05:27 02129_skip_quoted_fields: [ OK ] 21.74 sec.
2025-06-04 01:05:27 02695_logical_optimizer_alias_bug: [ OK ] 0.99 sec.
2025-06-04 01:05:27 00545_weird_aggregate_functions: [ OK ] 0.80 sec.
2025-06-04 01:05:27 01099_operators_date_and_timestamp: [ OK ] 10.26 sec.
2025-06-04 01:05:27 01798_having_push_down: [ OK ] 1.09 sec.
2025-06-04 01:05:27 02414_all_new_table_functions_must_be_documented: [ OK ] 0.79 sec.
2025-06-04 01:05:28 00008_array_join: [ OK ] 0.74 sec.
2025-06-04 01:05:28 02784_move_all_conditions_to_prewhere_analyzer_asan: [ OK ] 1.04 sec.
2025-06-04 01:05:28 03271_decimal_monotonic_day_of_week: [ OK ] 0.94 sec.
2025-06-04 01:05:28 03129_cte_with_final: [ OK ] 0.94 sec.
2025-06-04 01:05:29 02674_trivial_count_analyzer: [ OK ] 1.94 sec.
2025-06-04 01:05:29 00370_duplicate_columns_in_subqueries: [ OK ] 1.30 sec.
2025-06-04 01:05:29 01731_async_task_queue_wait: [ OK ] 3.40 sec.
2025-06-04 01:05:30 03299_deep_nested_map_creation: [ OK ] 0.85 sec.
2025-06-04 01:05:30 03148_setting_max_streams_to_max_threads_ratio_overflow: [ OK ] 1.66 sec.
2025-06-04 01:05:30 01528_allow_nondeterministic_optimize_skip_unused_shards: [ OK ] 1.35 sec.
2025-06-04 01:05:31 02840_grace_hash_join_structure_mismatch: [ OK ] 0.99 sec.
2025-06-04 01:05:31 02793_implicit_pretty_format_settings: [ OK ] 2.19 sec.
2025-06-04 01:05:31 01813_quantileBfloat16_nans: [ OK ] 0.89 sec.
2025-06-04 01:05:32 00354_host_command_line_option: [ OK ] 3.90 sec.
2025-06-04 01:05:32 00065_shard_float_literals_formatting: [ OK ] 0.74 sec.
2025-06-04 01:05:32 01601_proxy_protocol: [ OK ] 1.54 sec.
2025-06-04 01:05:33 02427_mutate_and_zero_copy_replication_zookeeper: [ OK ] 2.15 sec.
2025-06-04 01:05:33 02834_array_exists_segfault: [ OK ] 1.10 sec.
2025-06-04 01:05:33 02454_create_table_with_custom_disk: [ OK ] 2.29 sec.
2025-06-04 01:05:33 01326_hostname_alias: [ OK ] 0.84 sec.
2025-06-04 01:05:34 00022_func_higher_order_and_constants: [ OK ] 0.70 sec.
2025-06-04 01:05:34 00228_shard_quantiles_deterministic_merge_overflow: [ OK ] 1.24 sec.
2025-06-04 01:05:34 00380_client_break_at_exception_in_batch_mode: [ OK ] 2.24 sec.
2025-06-04 01:05:35 03199_queries_with_new_analyzer: [ OK ] 1.14 sec.
2025-06-04 01:05:36 00515_shard_desc_table_functions_and_subqueries: [ OK ] 1.34 sec.
2025-06-04 01:05:36 01043_h3_edge_length_m: [ OK ] 0.70 sec.
2025-06-04 01:05:37 03092_analyzer_same_table_name_in_different_databases: [ OK ] 0.90 sec.
2025-06-04 01:05:38 02029_quantile_sanitizer: [ OK ] 1.25 sec.
2025-06-04 01:05:40 01822_short_circuit: [ OK ] 6.70 sec.
2025-06-04 01:05:41 01074_h3_range_check: [ OK ] 2.70 sec.
2025-06-04 01:05:42 02843_backup_use_same_password_for_base_backup: [ OK ] 12.23 sec.
2025-06-04 01:05:42 02963_remote_read_small_buffer_size_bug: [ OK ] 24.74 sec.
2025-06-04 01:05:42 03095_merge_and_buffer_tables: [ OK ] 1.24 sec.
2025-06-04 01:05:44 02540_duplicate_primary_key2: [ OK ] 1.50 sec.
2025-06-04 01:05:50 02456_async_inserts_logs: [ OK ] 9.67 sec.
2025-06-04 01:05:50 02124_insert_deduplication_token_materialized_views: [ OK ] 7.97 sec.
2025-06-04 01:05:51 00612_union_query_with_subquery: [ OK ] 0.94 sec.
2025-06-04 01:05:51 02112_skip_index_set_and_or: [ OK ] 0.74 sec.
2025-06-04 01:05:52 02582_analyzer_join_subquery_empty_column_list: [ OK ] 1.35 sec.
2025-06-04 01:05:52 03205_system_sync_replica_format: [ OK ] 0.69 sec.
2025-06-04 01:05:53 02494_parser_string_binary_literal: [ OK ] 1.44 sec.
2025-06-04 01:05:53 01610_client_spawn_editor: [ OK ] 0.50 sec.
2025-06-04 01:05:54 00952_input_function: [ OK ] 21.26 sec.
2025-06-04 01:05:55 02902_add_scalar_in_all_case: [ OK ] 1.04 sec.
2025-06-04 01:05:55 01492_format_readable_quantity: [ OK ] 0.75 sec.
2025-06-04 01:05:56 00558_aggregate_merge_totals_with_arenas: [ OK ] 0.90 sec.
2025-06-04 01:05:57 02813_seriesOutliersDetectTukey: [ OK ] 4.15 sec.
2025-06-04 01:05:57 02115_write_buffers_finalize: [ OK ] 21.24 sec.
2025-06-04 01:05:58 01440_big_int_exotic_casts: [ OK ] 3.09 sec.
2025-06-04 01:05:58 01710_projection_with_mixed_pipeline: [ OK ] 1.44 sec.
2025-06-04 01:05:58 01392_column_resolve: [ OK ] 1.10 sec.
2025-06-04 01:05:59 01655_window_functions_bug: [ OK ] 0.70 sec.
2025-06-04 01:05:59 02691_multiple_joins_backtick_identifiers: [ OK ] 1.14 sec.
2025-06-04 01:05:59 01646_rewrite_sum_if: [ OK ] 2.29 sec.
2025-06-04 01:05:59 01040_dictionary_invalidate_query_switchover_long: [ OK ] 17.48 sec.
2025-06-04 01:06:00 03033_analyzer_resolve_from_parent_scope: [ OK ] 1.44 sec.
2025-06-04 01:06:00 02876_s3_cluster_schema_inference_names_with_spaces: [ OK ] 0.95 sec.
2025-06-04 01:06:00 02842_suggest_http_page_in_error_message: [ OK ] 1.50 sec.
2025-06-04 01:06:00 02990_format_select_from_explain: [ OK ] 1.54 sec.
2025-06-04 01:06:01 01802_toDateTime64_large_values: [ OK ] 0.94 sec.
2025-06-04 01:06:01 00604_show_create_database: [ OK ] 0.65 sec.
2025-06-04 01:06:01 02969_functions_to_subcolumns_if_null: [ OK ] 1.11 sec.
2025-06-04 01:06:01 01097_pre_limit: [ OK ] 0.75 sec.
2025-06-04 01:06:02 02295_GROUP_BY_AggregateFunction: [ OK ] 1.49 sec.
2025-06-04 01:06:02 02417_null_variadic_behaviour: [ OK ] 2.94 sec.
2025-06-04 01:06:02 00758_array_reverse: [ OK ] 1.80 sec.
2025-06-04 01:06:04 00411_merge_tree_where_const_in_set: [ OK ] 1.25 sec.
2025-06-04 01:06:09 00825_protobuf_format_splitted_nested: [ OK ] 6.66 sec.
2025-06-04 01:06:09 03215_validate_type_in_alter_add_modify_column: [ OK ] 5.06 sec.
2025-06-04 01:06:10 02791_final_block_structure_mismatch_bug: [ OK ] 7.48 sec.
2025-06-04 01:06:11 01668_avg_weighted_ubsan: [ OK ] 0.98 sec.
2025-06-04 01:06:14 01901_in_literal_shard_prune: [ OK ] 1.98 sec.
2025-06-04 01:06:15 02015_async_inserts_2: [ OK ] 5.69 sec.
2025-06-04 01:06:15 03036_dynamic_read_shared_subcolumns_memory: [ SKIPPED ] 0.00 sec.
2025-06-04 01:06:15 Reason: not running for current build
2025-06-04 01:06:16 02813_func_now_and_alias: [ OK ] 1.04 sec.
2025-06-04 01:06:17 02400_memory_accounting_on_error: [ OK ] 7.60 sec.
2025-06-04 01:06:18 01552_dict_fixedstring: [ OK ] 1.50 sec.
2025-06-04 01:06:20 00936_function_result_with_operator_in: [ OK ] 4.92 sec.
2025-06-04 01:06:23 03038_move_partition_to_oneself_deadlock: [ OK ] 2.16 sec.
2025-06-04 01:06:24 02026_arrayDifference_const: [ OK ] 1.01 sec.
2025-06-04 01:06:27 01064_incremental_streaming_from_2_src_with_feedback: [ OK ] 25.03 sec.
2025-06-04 01:06:27 02174_cte_scalar_cache: [ OK ] 9.39 sec.
2025-06-04 01:06:29 00098_g_union_all: [ OK ] 1.93 sec.
2025-06-04 01:06:30 03247_generic_arrayMin_arrayMax_fixes: [ OK ] 4.76 sec.
2025-06-04 01:06:31 02932_group_by_null_fuzzer: [ OK ] 3.09 sec.
2025-06-04 01:06:32 02149_schema_inference: [ OK ] 48.07 sec.
2025-06-04 01:06:33 01471_top_k_range_check: [ OK ] 2.54 sec.
2025-06-04 01:06:35 00387_use_client_time_zone: [ OK ] 2.30 sec.
2025-06-04 01:06:36 02021_exponential_sum_shard: [ OK ] 18.57 sec.
2025-06-04 01:06:37 01051_window_view_parser_hop: [ OK ] 7.32 sec.
2025-06-04 01:06:38 02763_row_policy_storage_merge_alias: [ OK ] 6.24 sec.
2025-06-04 01:06:38 01676_range_hashed_dictionary: [ OK ] 5.85 sec.
2025-06-04 01:06:39 00991_system_parts_race_condition_long: [ OK ] 37.43 sec.
2025-06-04 01:06:39 00229_prewhere_column_missing: [ OK ] 2.32 sec.
2025-06-04 01:06:39 01580_column_const_comparision: [ OK ] 0.75 sec.
2025-06-04 01:06:40 01937_nested_chinese: [ OK ] 0.94 sec.
2025-06-04 01:06:40 01710_projection_optimize_materialize: [ OK ] 3.90 sec.
2025-06-04 01:06:40 02711_server_uuid_macro: [ OK ] 2.40 sec.
2025-06-04 01:06:40 00609_prewhere_and_default: [ OK ] 3.02 sec.
2025-06-04 01:06:41 01425_default_value_of_type_name: [ OK ] 0.79 sec.
2025-06-04 01:06:41 00462_json_true_false_literals: [ OK ] 0.84 sec.
2025-06-04 01:06:41 00521_multidimensional: [ OK ] 1.92 sec.
2025-06-04 01:06:41 00131_set_hashed: [ OK ] 0.74 sec.
2025-06-04 01:06:42 00527_totals_having_nullable: [ OK ] 0.84 sec.
2025-06-04 01:06:42 01825_type_json_missed_values: [ OK ] 1.40 sec.
2025-06-04 01:06:42 02367_analyzer_table_alias_columns: [ OK ] 1.14 sec.
2025-06-04 01:06:42 02176_toStartOfWeek_overflow_pruning: [ OK ] 1.19 sec.
2025-06-04 01:06:42 02030_function_mapContainsKeyLike: [ OK ] 1.44 sec.
2025-06-04 01:06:43 01774_case_sensitive_connection_id: [ OK ] 0.74 sec.
2025-06-04 01:06:44 02155_dictionary_comment: [ OK ] 2.15 sec.
2025-06-04 01:06:44 03161_lightweight_delete_projection: [ OK ] 1.90 sec.
2025-06-04 01:06:44 02250_lots_of_columns_in_csv_with_names: [ OK ] 5.05 sec.
2025-06-04 01:06:45 01389_filter_by_virtual_columns: [ OK ] 0.79 sec.
2025-06-04 01:06:47 02985_minmax_index_aggregate_function: [ OK ] 2.55 sec.
2025-06-04 01:06:48 02531_ipv4_arithmetic: [ OK ] 0.84 sec.
2025-06-04 01:06:48 02705_settings_check_changed_flag: [ OK ] 3.10 sec.
2025-06-04 01:06:48 02833_std_alias: [ OK ] 0.90 sec.
2025-06-04 01:06:50 02461_prewhere_row_level_policy_lightweight_delete: [ OK ] 7.31 sec.
2025-06-04 01:06:50 00944_ml_test: [ OK ] 1.44 sec.
2025-06-04 01:06:51 01532_collate_in_low_cardinality: [ OK ] 1.44 sec.
2025-06-04 01:06:51 01753_mutate_table_predicated_with_table: [ OK ] 1.19 sec.
2025-06-04 01:06:52 01683_dist_INSERT_block_structure_mismatch: [ OK ] 1.14 sec.
2025-06-04 01:06:52 01825_new_type_json_11: [ OK ] 9.64 sec.
2025-06-04 01:06:53 02112_delayed_clickhouse_client_with_queries_file: [ OK ] 2.34 sec.
2025-06-04 01:06:54 02354_window_expression_with_aggregation_expression: [ OK ] 0.90 sec.
2025-06-04 01:06:54 02815_no_throw_in_simple_queries: [ FAIL ] 5.90 sec.
2025-06-04 01:06:54 Reason: return code: 1
2025-06-04 01:06:54 expect: spawn id exp3 not open
2025-06-04 01:06:54 while executing
2025-06-04 01:06:54 "expect ":) ""
2025-06-04 01:06:54 , result:
2025-06-04 01:06:54
2025-06-04 01:06:54 Failed
2025-06-04 01:06:54 Failed
2025-06-04 01:06:54 Failed
2025-06-04 01:06:54 Failed
2025-06-04 01:06:54 Failed
2025-06-04 01:06:54 Failed
2025-06-04 01:06:54 Failed
2025-06-04 01:06:54 Failed
2025-06-04 01:06:54
2025-06-04 01:06:54 stdout:
2025-06-04 01:06:54 Failed
2025-06-04 01:06:54 Failed
2025-06-04 01:06:54 Failed
2025-06-04 01:06:54 Failed
2025-06-04 01:06:54 Failed
2025-06-04 01:06:54 Failed
2025-06-04 01:06:54 Failed
2025-06-04 01:06:54 Failed
2025-06-04 01:06:54
2025-06-04 01:06:54
2025-06-04 01:06:54 Settings used in the test: --max_insert_threads 2 --group_by_two_level_threshold 1000000 --group_by_two_level_threshold_bytes 14215256 --distributed_aggregation_memory_efficient 1 --fsync_metadata 1 --output_format_parallel_formatting 0 --input_format_parallel_parsing 0 --min_chunk_bytes_for_parallel_parsing 14486053 --max_read_buffer_size 737838 --prefer_localhost_replica 1 --max_block_size 99897 --max_joined_block_size_rows 52444 --max_threads 1 --optimize_append_index 1 --optimize_if_chain_to_multiif 1 --optimize_if_transform_strings_to_enum 1 --optimize_read_in_order 1 --optimize_or_like_chain 0 --optimize_substitute_columns 1 --enable_multiple_prewhere_read_steps 0 --read_in_order_two_level_merge_threshold 64 --optimize_aggregation_in_order 1 --aggregation_in_order_max_block_bytes 26072860 --use_uncompressed_cache 1 --min_bytes_to_use_direct_io 10737418240 --min_bytes_to_use_mmap_io 10737418240 --local_filesystem_read_method pread --remote_filesystem_read_method read --local_filesystem_read_prefetch 0 --filesystem_cache_segments_batch_size 3 --read_from_filesystem_cache_if_exists_otherwise_bypass_cache 1 --throw_on_error_from_cache_on_write_operations 1 --remote_filesystem_read_prefetch 1 --allow_prefetched_read_pool_for_remote_filesystem 1 --filesystem_prefetch_max_memory_usage 64Mi --filesystem_prefetches_limit 0 --filesystem_prefetch_min_bytes_for_single_read_task 8Mi --filesystem_prefetch_step_marks 50 --filesystem_prefetch_step_bytes 100Mi --compile_aggregate_expressions 1 --compile_sort_description 0 --merge_tree_coarse_index_granularity 31 --optimize_distinct_in_order 0 --max_bytes_before_external_sort 10672366754 --max_bytes_before_external_group_by 0 --max_bytes_before_remerge_sort 1044904604 --min_compress_block_size 2490907 --max_compress_block_size 2637721 --merge_tree_compact_parts_min_granules_to_multibuffer_read 29 --optimize_sorting_by_input_stream_properties 0 --http_response_buffer_size 1028329 --http_wait_end_of_query True --enable_memory_bound_merging_of_aggregation_results 1 --min_count_to_compile_expression 0 --min_count_to_compile_aggregate_expression 0 --min_count_to_compile_sort_description 3 --session_timezone America/Hermosillo --use_page_cache_for_disks_without_file_cache True --page_cache_inject_eviction False --merge_tree_read_split_ranges_into_intersecting_and_non_intersecting_injection_probability 0.25 --prefer_external_sort_block_bytes 1 --cross_join_min_rows_to_compress 0 --cross_join_min_bytes_to_compress 100000000 --min_external_table_block_size_bytes 100000000 --max_parsing_threads 10 --optimize_functions_to_subcolumns 1 --parallel_replicas_local_plan 1
2025-06-04 01:06:54
2025-06-04 01:06:54 MergeTree settings used in test: --ratio_of_defaults_for_sparse_serialization 1.0 --prefer_fetch_merged_part_size_threshold 10737418240 --vertical_merge_algorithm_min_rows_to_activate 1000000 --vertical_merge_algorithm_min_columns_to_activate 1 --allow_vertical_merges_from_compact_to_wide_parts 1 --min_merge_bytes_to_use_direct_io 10737418240 --index_granularity_bytes 8086869 --merge_max_block_size 13760 --index_granularity 17418 --min_bytes_for_wide_part 217568460 --marks_compress_block_size 36634 --primary_key_compress_block_size 46317 --replace_long_file_name_to_hash 0 --max_file_name_length 76 --min_bytes_for_full_part_storage 0 --compact_parts_max_bytes_to_buffer 427919980 --compact_parts_max_granules_to_buffer 235 --compact_parts_merge_max_bytes_to_prefetch_part 19505925 --cache_populated_by_fetch 0 --concurrent_part_removal_threshold 89 --old_parts_lifetime 10
2025-06-04 01:06:54
2025-06-04 01:06:54 Database: test_3iyayh5z
2025-06-04 01:06:54 02538_alter_rename_sequence: [ OK ] 2.15 sec.
2025-06-04 01:06:55 01703_rewrite_aggregate_function_case_insensitive: [ OK ] 0.94 sec.
2025-06-04 01:06:56 01019_array_fill: [ OK ] 1.24 sec.
2025-06-04 01:06:57 02456_alter-nullable-column-bag: [ OK ] 1.15 sec.
2025-06-04 01:06:57 01660_join_or_all: [ OK ] 4.31 sec.
2025-06-04 01:06:57 02267_insert_empty_data: [ OK ] 0.69 sec.
2025-06-04 01:06:57 01710_projections_optimize_aggregation_in_order: [ OK ] 15.88 sec.
2025-06-04 01:06:58 02002_system_table_with_tuple: [ OK ] 2.20 sec.
2025-06-04 01:06:59 02473_multistep_split_prewhere: [ OK ] 92.64 sec.
2025-06-04 01:07:00 02564_read_in_order_final_desc: [ OK ] 1.09 sec.
2025-06-04 01:07:01 02384_analyzer_dict_get_join_get: [ OK ] 2.75 sec.
2025-06-04 01:07:02 01780_column_sparse_full: [ OK ] 4.16 sec.
2025-06-04 01:07:02 00551_parse_or_null: [ OK ] 0.84 sec.
2025-06-04 01:07:02 02941_variant_type_4: [ OK ] 88.34 sec.
2025-06-04 01:07:03 02041_test_fuzzy_alter: [ OK ] 1.29 sec.
2025-06-04 01:07:04 00687_insert_into_mv: [ OK ] 1.39 sec.
2025-06-04 01:07:04 02160_special_functions: [ OK ] 2.05 sec.
2025-06-04 01:07:04 01328_bad_peephole_optimization: [ OK ] 0.69 sec.
2025-06-04 01:07:06 02707_analyzer_nested_lambdas_types: [ OK ] 0.99 sec.
2025-06-04 01:07:06 00503_cast_const_nullable: [ OK ] 0.84 sec.
2025-06-04 01:07:07 02354_vector_search_bugs: [ OK ] 4.35 sec.
2025-06-04 01:07:08 02263_format_insert_settings: [ OK ] 10.51 sec.
2025-06-04 01:07:09 00964_bloom_index_string_functions: [ OK ] 24.66 sec.
2025-06-04 01:07:09 02150_replace_regexp_all_empty_match: [ OK ] 0.80 sec.
2025-06-04 01:07:10 02158_ztest_cmp: [ OK ] 3.30 sec.
2025-06-04 01:07:11 02841_parallel_final_wrong_columns_order: [ OK ] 6.75 sec.
2025-06-04 01:07:12 01866_view_persist_settings: [ OK ] 4.06 sec.
2025-06-04 01:07:12 02920_alter_column_of_projections: [ OK ] 2.85 sec.
2025-06-04 01:07:12 02895_peak_memory_usage_http_headers_regression: [ OK ] 2.40 sec.
2025-06-04 01:07:13 01375_null_issue_3767: [ OK ] 0.94 sec.
2025-06-04 01:07:14 03010_view_prewhere_in: [ OK ] 1.39 sec.
2025-06-04 01:07:15 03161_cnf_reduction: [ OK ] 2.60 sec.
2025-06-04 01:07:20 02229_client_stop_multiquery_in_SIGINT: [ OK ] 8.93 sec.
2025-06-04 01:07:21 02910_bad_logs_level_in_local: [ OK ] 1.15 sec.
2025-06-04 01:07:22 02235_add_part_offset_virtual_column: [ OK ] 9.72 sec.
2025-06-04 01:07:24 02956_clickhouse_local_system_parts: [ OK ] 2.57 sec.
2025-06-04 01:07:25 00009_array_join_subquery: [ OK ] 0.96 sec.
2025-06-04 01:07:26 03261_test_merge_parquet_bloom_filter_minmax_stats: [ OK ] 4.00 sec.
2025-06-04 01:07:27 00476_pretty_formats_and_widths: [ OK ] 1.19 sec.
2025-06-04 01:07:28 02477_invalid_reads: [ OK ] 13.81 sec.
2025-06-04 01:07:29 01032_cityHash64_for_UUID: [ OK ] 1.62 sec.
2025-06-04 01:07:29 02476_fix_cast_parser_bug: [ OK ] 0.69 sec.
2025-06-04 01:07:30 03172_http_content_encoding: [ OK ] 5.55 sec.
2025-06-04 01:07:31 01416_join_totals_header_bug: [ OK ] 1.45 sec.
2025-06-04 01:07:32 00298_enum_width_and_cast: [ OK ] 1.34 sec.
2025-06-04 01:07:32 02471_wrong_date_monotonicity: [ OK ] 1.11 sec.
2025-06-04 01:07:32 01104_fixed_string_like: [ OK ] 2.71 sec.
2025-06-04 01:07:33 00209_insert_select_extremes: [ OK ] 1.26 sec.
2025-06-04 01:07:35 02521_tsv_csv_custom_header_detection: [ OK ] 37.68 sec.
2025-06-04 01:07:35 03069_analyzer_with_alias_in_array_join: [ OK ] 0.79 sec.
2025-06-04 01:07:38 02681_aggregation_by_partitions_bug: [ OK ] 2.27 sec.
2025-06-04 01:07:40 02150_index_hypothesis_race_long: [ OK ] 30.96 sec.
2025-06-04 01:07:41 02563_async_insert_bad_data: [ OK ] 9.31 sec.
2025-06-04 01:07:42 02301_harmful_reexec: [ OK ] 2.64 sec.
2025-06-04 01:07:44 02973_block_number_sparse_serialization_and_mutation: [ OK ] 2.44 sec.
2025-06-04 01:07:44 02221_parallel_replicas_bug: [ OK ] 11.07 sec.
2025-06-04 01:07:45 01681_bloom_filter_nullable_column: [ OK ] 2.70 sec.
2025-06-04 01:07:46 02416_rocksdb_delete_update: [ OK ] 2.09 sec.
2025-06-04 01:07:47 03039_dynamic_aggregating_merge_tree: [ OK ] 46.75 sec.
2025-06-04 01:07:47 01034_JSONCompactEachRow: [ OK ] 3.35 sec.
2025-06-04 01:07:48 03290_final_collapsing: [ OK ] 1.64 sec.
2025-06-04 01:07:48 00857_global_joinsavel_table_alias: [ OK ] 2.84 sec.
2025-06-04 01:07:48 00205_emptyscalar_subquery_type_mismatch_bug: [ OK ] 1.14 sec.
2025-06-04 01:07:48 01505_pipeline_executor_UAF: [ OK ] 34.28 sec.
2025-06-04 01:07:49 00447_foreach_modifier: [ OK ] 1.69 sec.
2025-06-04 01:07:49 02771_if_constant_folding: [ OK ] 0.79 sec.
2025-06-04 01:07:50 02515_and_or_if_multiif_not_return_lc: [ OK ] 0.94 sec.
2025-06-04 01:07:50 02479_if_with_null_and_cullable_const: [ OK ] 0.81 sec.
2025-06-04 01:07:50 03167_base64_url_functions: [ OK ] 2.09 sec.
2025-06-04 01:07:51 01926_date_date_time_supertype: [ OK ] 1.30 sec.
2025-06-04 01:07:52 01585_use_index_for_global_in: [ OK ] 1.44 sec.
2025-06-04 01:07:52 02128_cast_nullable: [ OK ] 0.89 sec.
2025-06-04 01:07:53 00522_multidimensional: [ OK ] 4.60 sec.
2025-06-04 01:07:53 01576_alias_column_rewrite: [ OK ] 4.85 sec.
2025-06-04 01:07:54 02294_dictionaries_hierarchical_index: [ OK ] 2.30 sec.
2025-06-04 01:07:54 01881_create_as_tuple: [ OK ] 1.10 sec.
2025-06-04 01:07:55 01474_decimal_scale_bug: [ OK ] 1.69 sec.
2025-06-04 01:07:55 02204_fractional_progress_bar_long: [ SKIPPED ] 0.00 sec.
2025-06-04 01:07:55 Reason: not running for current build
2025-06-04 01:07:55 00534_functions_bad_arguments11: [ OK ] 60.51 sec.
2025-06-04 01:07:55 02553_type_object_analyzer: [ OK ] 1.19 sec.
2025-06-04 01:07:56 01710_projections_group_by_no_key: [ OK ] 1.09 sec.
2025-06-04 01:07:56 02918_template_format_deadlock: [ OK ] 2.10 sec.
2025-06-04 01:07:57 01755_shard_pruning_with_literal: [ OK ] 1.05 sec.
2025-06-04 01:07:57 01293_pretty_max_value_width: [ OK ] 1.84 sec.
2025-06-04 01:07:58 00974_primary_key_for_lowCardinality: [ OK ] 7.66 sec.
2025-06-04 01:07:58 00802_daylight_saving_time_shift_backwards_at_midnight: [ OK ] 1.00 sec.
2025-06-04 01:07:58 03033_lightweight_deletes_sync: [ OK ] 1.34 sec.
2025-06-04 01:07:58 00986_materialized_view_stack_overflow: [ OK ] 2.90 sec.
2025-06-04 01:07:59 00434_tonullable: [ OK ] 0.75 sec.
2025-06-04 01:07:59 01960_lambda_precedence: [ OK ] 0.85 sec.
2025-06-04 01:08:00 02243_in_ip_address: [ OK ] 1.04 sec.
2025-06-04 01:08:00 02112_delayed_clickhouse_local: [ OK ] 2.14 sec.
2025-06-04 01:08:01 02713_sequence_match_serialization_fix: [ OK ] 1.36 sec.
2025-06-04 01:08:01 02797_range_nullable: [ OK ] 2.50 sec.
2025-06-04 01:08:02 02455_extract_fixed_string_from_nested_json: [ OK ] 0.90 sec.
2025-06-04 01:08:02 01949_heredoc_unfinished: [ OK ] 1.74 sec.
2025-06-04 01:08:03 03002_analyzer_prewhere: [ OK ] 1.64 sec.
2025-06-04 01:08:04 02703_max_local_read_bandwidth: [ OK ] 32.12 sec.
2025-06-04 01:08:05 00719_insert_block_without_column: [ OK ] 4.70 sec.
2025-06-04 01:08:06 00740_database_in_nested_view: [ OK ] 1.34 sec.
2025-06-04 01:08:06 01082_bit_test_out_of_bound: [ OK ] 4.05 sec.
2025-06-04 01:08:07 01096_zeros: [ OK ] 1.34 sec.
2025-06-04 01:08:07 02731_nothing_deserialization: [ OK ] 1.30 sec.
2025-06-04 01:08:08 01079_alter_default_zookeeper_long: [ OK ] 4.50 sec.
2025-06-04 01:08:08 02113_untuple_func_alias: [ OK ] 0.69 sec.
2025-06-04 01:08:08 02426_pod_array_overflow_3: [ OK ] 0.59 sec.
2025-06-04 01:08:09 02536_date_from_number_inference_fix: [ OK ] 0.84 sec.
2025-06-04 01:08:10 02931_size_virtual_column_use_structure_from_insertion_table: [ OK ] 2.10 sec.
2025-06-04 01:08:11 03284_json_object_as_tuple_duplicate_keys: [ OK ] 1.50 sec.
2025-06-04 01:08:11 02845_parquet_odd_decimals: [ OK ] 3.90 sec.
2025-06-04 01:08:12 01432_parse_date_time_best_effort_timestamp: [ OK ] 0.89 sec.
2025-06-04 01:08:12 02234_position_case_insensitive_utf8: [ OK ] 0.85 sec.
2025-06-04 01:08:13 02351_Map_combinator_dist: [ OK ] 2.09 sec.
2025-06-04 01:08:13 00369_int_div_of_float: [ OK ] 0.89 sec.
2025-06-04 01:08:14 00555_right_join_excessive_rows: [ OK ] 0.84 sec.
2025-06-04 01:08:14 01333_select_abc_asterisk: [ OK ] 1.34 sec.
2025-06-04 01:08:14 02783_parallel_replicas_trivial_count_optimization: [ OK ] 9.26 sec.
2025-06-04 01:08:15 01655_agg_if_nullable: [ OK ] 0.89 sec.
2025-06-04 01:08:16 01509_format_raw_blob: [ OK ] 4.05 sec.
2025-06-04 01:08:16 03209_json_type_horizontal_merges: [ SKIPPED ] 0.00 sec.
2025-06-04 01:08:16 Reason: not running for current build
2025-06-04 01:08:16 00974_low_cardinality_cast: [ OK ] 2.34 sec.
2025-06-04 01:08:17 03005_input_function_in_join: [ OK ] 0.89 sec.
2025-06-04 01:08:17 01049_zookeeper_synchronous_mutations_long: [ OK ] 2.61 sec.
2025-06-04 01:08:17 01620_fix_simple_state_arg_type: [ OK ] 1.40 sec.
2025-06-04 01:08:18 00075_shard_formatting_negate_of_negative_literal: [ OK ] 0.94 sec.
2025-06-04 01:08:18 01036_union_different_columns: [ OK ] 0.94 sec.
2025-06-04 01:08:21 00834_limit_with_constant_expressions: [ OK ] 3.40 sec.
2025-06-04 01:08:22 02381_join_dup_columns_in_plan: [ OK ] 3.00 sec.
2025-06-04 01:08:22 01925_json_as_string_data_in_square_brackets: [ OK ] 0.94 sec.
2025-06-04 01:08:23 03032_rmt_create_columns_from_replica: [ OK ] 0.89 sec.
2025-06-04 01:08:24 00050_any_left_join: [ OK ] 0.86 sec.
2025-06-04 01:08:24 01011_group_uniq_array_memsan: [ OK ] 0.80 sec.
2025-06-04 01:08:25 01508_race_condition_rename_clear_zookeeper_long: [ OK ] 32.98 sec.
2025-06-04 01:08:25 01196_max_parser_depth: [ OK ] 3.50 sec.
2025-06-04 01:08:25 01825_new_type_json_multiple_files: [ OK ] 11.47 sec.
2025-06-04 01:08:26 01037_zookeeper_check_table_empty_pk: [ OK ] 1.44 sec.
2025-06-04 01:08:26 00945_bloom_filter_index: [ OK ] 25.11 sec.
2025-06-04 01:08:28 02125_dict_get_type_nullable_fix: [ OK ] 1.75 sec.
2025-06-04 01:08:28 00809_add_days_segfault: [ OK ] 2.50 sec.
2025-06-04 01:08:28 02228_unquoted_dates_in_csv_schema_inference: [ OK ] 2.05 sec.
2025-06-04 01:08:29 00088_distinct_of_arrays_of_strings: [ OK ] 0.80 sec.
2025-06-04 01:08:30 02554_invalid_create_view_syntax: [ OK ] 0.59 sec.
2025-06-04 01:08:32 03155_test_move_to_prewhere: [ OK ] 4.10 sec.
2025-06-04 01:08:33 02374_in_tuple_index: [ OK ] 0.99 sec.
2025-06-04 01:08:35 00875_join_right_nulls_ors: [ OK ] 2.05 sec.
2025-06-04 01:08:37 00534_functions_bad_arguments8: [ OK ] 59.29 sec.
2025-06-04 01:08:37 01472_toBoundsOfInterval_disallow_empty_tz_field: [ OK ] 9.22 sec.
2025-06-04 01:08:38 00534_functions_bad_arguments2: [ OK ] 41.95 sec.
2025-06-04 01:08:39 01308_row_policy_and_trivial_count_query: [ OK ] 1.25 sec.
2025-06-04 01:08:39 02790_fix_coredump_when_compile_expression: [ OK ] 0.79 sec.
2025-06-04 01:08:39 01784_parallel_formatting_memory: [ OK ] 2.09 sec.
2025-06-04 01:08:40 03230_subcolumns_mv: [ OK ] 1.14 sec.
2025-06-04 01:08:42 01262_low_cardinality_remove: [ OK ] 1.40 sec.
2025-06-04 01:08:43 02176_dict_get_has_implicit_key_cast: [ OK ] 4.06 sec.
2025-06-04 01:08:44 01458_is_decimal_overflow: [ OK ] 1.95 sec.
2025-06-04 01:08:44 01550_mutation_subquery: [ OK ] 1.19 sec.
2025-06-04 01:08:45 01355_CSV_input_format_allow_errors: [ OK ] 9.26 sec.
2025-06-04 01:08:45 02810_fix_remove_dedundant_distinct_view: [ OK ] 1.30 sec.
2025-06-04 01:08:46 01245_limit_infinite_sources: [ OK ] 1.55 sec.
2025-06-04 01:08:46 02981_translate_fixedstring: [ OK ] 0.84 sec.
2025-06-04 01:08:46 02872_prewhere_filter: [ OK ] 0.94 sec.
2025-06-04 01:08:47 00357_to_string_complex_types: [ OK ] 1.09 sec.
2025-06-04 01:08:47 01264_nested_baloo_bear: [ OK ] 1.10 sec.
2025-06-04 01:08:47 01406_carriage_return_in_tsv_csv: [ OK ] 7.61 sec.
2025-06-04 01:08:48 02661_read_from_archive_targz: [ OK ] 29.76 sec.
2025-06-04 01:08:48 00538_datediff_plural_units: [ OK ] 1.30 sec.
2025-06-04 01:08:49 02481_pk_analysis_with_enum_to_string: [ OK ] 1.60 sec.
2025-06-04 01:08:49 03068_analyzer_distributed_join: [ OK ] 1.64 sec.
2025-06-04 01:08:50 03127_argMin_combinator_state: [ OK ] 1.25 sec.
2025-06-04 01:08:50 02364_dictionary_datetime_64_attribute_crash: [ OK ] 1.04 sec.
2025-06-04 01:08:50 01089_alter_settings_old_format: [ OK ] 1.35 sec.
2025-06-04 01:08:51 00808_not_optimize_predicate: [ OK ] 2.84 sec.
2025-06-04 01:08:51 00906_low_cardinality_rollup: [ OK ] 1.34 sec.
2025-06-04 01:08:52 00520_http_nullable: [ OK ] 1.85 sec.
2025-06-04 01:08:52 02370_lost_part_intersecting_merges: [ OK ] 26.45 sec.
2025-06-04 01:08:53 03150_grouping_sets_use_nulls_pushdown: [ OK ] 1.61 sec.
2025-06-04 01:08:53 03240_insert_select_named_tuple: [ OK ] 1.50 sec.
2025-06-04 01:08:53 00969_columns_clause: [ OK ] 1.99 sec.
2025-06-04 01:08:54 02813_seriesDecomposeSTL: [ OK ] 3.55 sec.
2025-06-04 01:08:54 00649_quantile_tdigest_negative: [ OK ] 0.74 sec.
2025-06-04 01:08:55 00688_low_cardinality_alter_add_column: [ OK ] 1.04 sec.
2025-06-04 01:08:55 00831_quantile_weighted_parameter_check: [ OK ] 1.55 sec.
2025-06-04 01:08:55 01681_hyperscan_debug_assertion: [ OK ] 3.20 sec.
2025-06-04 01:08:55 02012_sha512_fixedstring: [ OK ] 1.16 sec.
2025-06-04 01:08:57 02366_kql_operator_in_sql: [ OK ] 2.24 sec.
2025-06-04 01:09:00 00829_bitmap64_function: [ OK ] 2.25 sec.
2025-06-04 01:09:00 00753_alter_attach: [ OK ] 7.37 sec.
2025-06-04 01:09:00 00287_column_const_with_nan: [ OK ] 0.85 sec.
2025-06-04 01:09:02 03152_analyzer_columns_list: [ OK ] 1.49 sec.
2025-06-04 01:09:03 00700_decimal_math: [ OK ] 2.36 sec.
2025-06-04 01:09:03 02973_dictionary_table_exception_fix: [ OK ] 1.20 sec.
2025-06-04 01:09:04 01010_partial_merge_join: [ OK ] 9.28 sec.
2025-06-04 01:09:04 00284_external_aggregation_2: [ OK ] 38.90 sec.
2025-06-04 01:09:05 01284_escape_sequences_php_mysql_style: [ OK ] 1.64 sec.
2025-06-04 01:09:05 01880_materialized_view_to_table_type_check: [ OK ] 2.11 sec.
2025-06-04 01:09:06 02562_native_tskv_default_for_omitted_fields: [ OK ] 10.36 sec.
2025-06-04 01:09:07 01851_hedged_connections_external_tables: [ OK ] 0.95 sec.
2025-06-04 01:09:07 02969_analyzer_eliminate_injective_functions: [ OK ] 1.09 sec.
2025-06-04 01:09:07 02833_tuple_concat: [ OK ] 2.66 sec.
2025-06-04 01:09:09 02352_interactive_queries_from_file: [ OK ] 2.56 sec.
2025-06-04 01:09:10 01098_msgpack_format: [ OK ] 40.03 sec.
2025-06-04 01:09:10 02967_parallel_replicas_joins_and_analyzer: [ OK ] 14.37 sec.
2025-06-04 01:09:11 01921_test_progress_bar: [ OK ] 0.84 sec.
2025-06-04 01:09:12 02842_table_function_file_filter_by_virtual_columns: [ OK ] 2.70 sec.
2025-06-04 01:09:13 02751_protobuf_ipv6: [ OK ] 2.96 sec.
2025-06-04 01:09:13 02981_variant_type_function: [ OK ] 2.30 sec.
2025-06-04 01:09:13 00534_exp10: [ OK ] 0.86 sec.
2025-06-04 01:09:14 02861_join_on_nullsafe_compare: [ OK ] 7.41 sec.
2025-06-04 01:09:14 00311_array_primary_key: [ OK ] 1.50 sec.
2025-06-04 01:09:15 02345_create_table_allow_trailing_comma: [ OK ] 1.24 sec.
2025-06-04 01:09:15 01021_only_tuple_columns: [ OK ] 1.65 sec.
2025-06-04 01:09:15 02149_issue_32487: [ OK ] 0.79 sec.
2025-06-04 01:09:15 02921_bit_hamming_distance_big_int: [ OK ] 1.31 sec.
2025-06-04 01:09:16 00098_1_union_all: [ OK ] 1.50 sec.
2025-06-04 01:09:17 00122_join_with_subquery_with_subquery: [ OK ] 0.81 sec.
2025-06-04 01:09:17 03156_nullable_number_tips: [ OK ] 1.76 sec.
2025-06-04 01:09:18 01354_tuple_low_cardinality_array_mapped_bug: [ OK ] 1.05 sec.
2025-06-04 01:09:19 01666_merge_tree_max_query_limit: [ OK ] 14.38 sec.
2025-06-04 01:09:19 02896_cyclic_aliases_crash: [ OK ] 2.07 sec.
2025-06-04 01:09:21 01650_fetch_patition_with_macro_in_zk_path_long: [ OK ] 1.86 sec.
2025-06-04 01:09:22 02570_fallback_from_async_insert: [ OK ] 7.12 sec.
2025-06-04 01:09:23 02053_INSERT_SELECT_MATERIALIZED: [ OK ] 1.05 sec.
2025-06-04 01:09:25 03199_unbin_buffer_overflow: [ OK ] 17.08 sec.
2025-06-04 01:09:25 01463_resample_overflow: [ OK ] 1.25 sec.
2025-06-04 01:09:25 01834_alias_columns_laziness_filimonov: [ OK ] 3.76 sec.
2025-06-04 01:09:25 03202_dynamic_null_map_subcolumn: [ OK ] 9.98 sec.
2025-06-04 01:09:26 02115_map_contains_analyzer: [ OK ] 1.01 sec.
2025-06-04 01:09:26 02972_insert_deduplication_token_hierarchical_inserts_views: [ OK ] 6.42 sec.
2025-06-04 01:09:26 03034_recursive_cte_tree: [ OK ] 1.55 sec.
2025-06-04 01:09:27 01825_type_json_18: [ OK ] 1.10 sec.
2025-06-04 01:09:27 03171_direct_dict_short_circuit_bug: [ OK ] 1.45 sec.
2025-06-04 01:09:28 01049_join_low_card_crash: [ OK ] 1.81 sec.
2025-06-04 01:09:28 03144_invalid_filter: [ OK ] 2.06 sec.
2025-06-04 01:09:28 01762_deltasumtimestamp: [ OK ] 1.56 sec.
2025-06-04 01:09:29 01780_range_msan: [ OK ] 1.46 sec.
2025-06-04 01:09:29 01421_array_nullable_element_nullable_index: [ OK ] 0.96 sec.
2025-06-04 01:09:29 03032_save_bad_json_escape_sequences: [ OK ] 0.86 sec.
2025-06-04 01:09:30 01356_initialize_aggregation: [ OK ] 1.25 sec.
2025-06-04 01:09:30 01669_test_toYear_mysql_dialect: [ OK ] 0.80 sec.
2025-06-04 01:09:30 02504_regexp_dictionary_ua_parser: [ OK ] 12.53 sec.
2025-06-04 01:09:31 00688_low_cardinality_syntax: [ OK ] 2.81 sec.
2025-06-04 01:09:31 02687_native_fuzz: [ OK ] 1.20 sec.
2025-06-04 01:09:31 01303_polygons_equals: [ OK ] 0.85 sec.
2025-06-04 01:09:33 02343_group_by_use_nulls: [ OK ] 1.71 sec.
2025-06-04 01:09:33 02752_space_function: [ OK ] 4.26 sec.
2025-06-04 01:09:34 03134_positional_arguments: [ OK ] 8.92 sec.
2025-06-04 01:09:34 02477_exists_fuzz_43478: [ OK ] 0.95 sec.
2025-06-04 01:09:35 00975_json_hang: [ OK ] 3.67 sec.
2025-06-04 01:09:35 00942_mv_rename_table: [ OK ] 1.15 sec.
2025-06-04 01:09:35 02293_grouping_function_group_by: [ OK ] 4.73 sec.
2025-06-04 01:09:36 01710_projection_aggregate_functions_null_for_empty: [ OK ] 1.00 sec.
2025-06-04 01:09:36 03145_unicode_quotes: [ OK ] 0.90 sec.
2025-06-04 01:09:36 00071_insert_fewer_columns: [ OK ] 1.15 sec.
2025-06-04 01:09:38 01135_default_and_alter_zookeeper: [ OK ] 1.51 sec.
2025-06-04 01:09:38 01273_arrow_nullable_arrays_load: [ OK ] 5.46 sec.
2025-06-04 01:09:39 02207_s3_content_type: [ OK ] 2.63 sec.
2025-06-04 01:09:39 02565_update_empty_nested: [ OK ] 1.80 sec.
2025-06-04 01:09:40 03034_dynamic_conversions: [ OK ] 5.10 sec.
2025-06-04 01:09:40 01935_parametrized_query_parametric_aggregate_function: [ OK ] 1.50 sec.
2025-06-04 01:09:40 03143_group_by_constant_secondary: [ OK ] 0.79 sec.
2025-06-04 01:09:40 00098_shard_i_union_all: [ OK ] 1.65 sec.
2025-06-04 01:09:41 00904_array_with_constant_2: [ OK ] 1.02 sec.
2025-06-04 01:09:42 03071_analyzer_array_join_forbid_non_existing_columns: [ OK ] 1.26 sec.
2025-06-04 01:09:42 01710_projection_with_column_transformers: [ OK ] 0.99 sec.
2025-06-04 01:09:43 02325_dates_schema_inference: [ OK ] 2.60 sec.
2025-06-04 01:09:43 02923_cte_equality_disjunction: [ OK ] 0.87 sec.
2025-06-04 01:09:43 01444_create_table_drop_database_race: [ OK ] 12.00 sec.
2025-06-04 01:09:44 02792_alter_table_modify_comment: [ OK ] 4.41 sec.
2025-06-04 01:09:44 03222_json_squashing: [ OK ] 7.81 sec.
2025-06-04 01:09:46 00700_decimal_null: [ OK ] 3.11 sec.
2025-06-04 01:09:46 00804_test_custom_compression_codes_log_storages: [ OK ] 3.40 sec.
2025-06-04 01:09:47 01747_alter_partition_key_enum_zookeeper_long: [ OK ] 2.96 sec.
2025-06-04 01:09:47 01616_untuple_access_field: [ OK ] 0.80 sec.
2025-06-04 01:09:48 03037_dot_product_overflow: [ OK ] 0.76 sec.
2025-06-04 01:09:48 01710_normal_projection_format: [ OK ] 0.90 sec.
2025-06-04 01:09:49 00836_indices_alter_replicated_zookeeper_long: [ OK ] 5.67 sec.
2025-06-04 01:09:50 00053_all_inner_join: [ OK ] 0.85 sec.
2025-06-04 01:09:51 02316_const_string_intersact: [ OK ] 0.80 sec.
2025-06-04 01:09:52 03007_column_nullable_uninitialzed_value: [ OK ] 0.87 sec.
2025-06-04 01:09:53 01079_new_range_reader_segfault: [ OK ] 1.15 sec.
2025-06-04 01:09:54 01925_jit_aggregation_function_count_long: [ OK ] 1.09 sec.
2025-06-04 01:09:57 02125_lz4_compression_bug_JSONCompactEachRow: [ OK ] 15.60 sec.
2025-06-04 01:09:59 01549_low_cardinality_mv_fuzz: [ OK ] 1.07 sec.
2025-06-04 01:10:00 03246_json_simd_rapid_parsers: [ OK ] 5.73 sec.
2025-06-04 01:10:00 02421_truncate_isolation_no_merges: [ OK ] 55.85 sec.
2025-06-04 01:10:02 01318_encrypt: [ OK ] 12.97 sec.
2025-06-04 01:10:02 01505_log_distributed_deadlock: [ OK ] 1.63 sec.
2025-06-04 01:10:03 02047_log_family_complex_structs_data_file_dumps: [ OK ] 16.84 sec.
2025-06-04 01:10:06 02474_extract_fixedstring_from_json: [ OK ] 2.09 sec.
2025-06-04 01:10:07 00181_aggregate_functions_statistics_stable: [ OK ] 5.16 sec.
2025-06-04 01:10:08 02984_form_format: [ OK ] 6.04 sec.
2025-06-04 01:10:08 03032_numbers_zeros: [ OK ] 2.23 sec.
2025-06-04 01:10:09 02479_analyzer_aggregation_crash: [ OK ] 1.25 sec.
2025-06-04 01:10:12 02243_make_date32_mysql: [ OK ] 3.75 sec.
2025-06-04 01:10:14 00666_uniq_complex_types: [ OK ] 4.16 sec.
2025-06-04 01:10:14 00400_client_external_options: [ OK ] 5.96 sec.
2025-06-04 01:10:16 02982_comments_in_system_tables: [ OK ] 3.48 sec.
2025-06-04 01:10:16 02579_fill_empty_chunk_analyzer: [ OK ] 2.01 sec.
2025-06-04 01:10:17 02798_explain_settings_not_applied_bug: [ OK ] 2.97 sec.
2025-06-04 01:10:18 03200_subcolumns_join_use_nulls: [ OK ] 2.13 sec.
2025-06-04 01:10:19 02247_read_bools_as_numbers_json: [ OK ] 19.62 sec.
2025-06-04 01:10:20 02041_openssl_hash_functions_test: [ OK ] 1.32 sec.
2025-06-04 01:10:20 00931_low_cardinality_nullable_aggregate_function_type: [ OK ] 3.03 sec.
2025-06-04 01:10:20 03009_format_show_database: [ OK ] 4.27 sec.
2025-06-04 01:10:22 01359_geodistance_loop: [ OK ] 0.85 sec.
2025-06-04 01:10:27 01655_plan_optimizations: [ OK ] 42.91 sec.
2025-06-04 01:10:30 02493_max_streams_for_merge_tree_reading: [ OK ] 30.01 sec.
2025-06-04 01:10:30 00849_multiple_comma_join_2: [ OK ] 10.33 sec.
2025-06-04 01:10:32 01632_tinylog_read_write: [ OK ] 12.64 sec.
2025-06-04 01:10:32 02345_filesystem_local: [ OK ] 2.12 sec.
2025-06-04 01:10:32 00104_totals_having_mode: [ OK ] 4.95 sec.
2025-06-04 01:10:33 02766_bitshift_with_const_arguments: [ OK ] 2.30 sec.
2025-06-04 01:10:33 02020_exponential_smoothing: [ OK ] 10.96 sec.
2025-06-04 01:10:33 02523_range_const_start: [ OK ] 0.76 sec.
2025-06-04 01:10:33 02241_short_circuit_short_column: [ OK ] 0.91 sec.
2025-06-04 01:10:33 02456_test_zero_copy_mutation: [ OK ] 1.72 sec.
2025-06-04 01:10:34 03008_index_small: [ OK ] 1.19 sec.
2025-06-04 01:10:34 01585_fuzz_bits_with_bugfix: [ OK ] 0.85 sec.
2025-06-04 01:10:36 02931_alter_materialized_view_query_inconsistent: [ OK ] 1.50 sec.
2025-06-04 01:10:36 00196_float32_formatting: [ OK ] 1.35 sec.
2025-06-04 01:10:37 02296_nullable_arguments_in_array_filter: [ OK ] 1.14 sec.
2025-06-04 01:10:38 01699_timezoneOffset: [ OK ] 4.20 sec.
2025-06-04 01:10:38 02203_shebang: [ OK ] 2.26 sec.
2025-06-04 01:10:38 02904_empty_order_by_with_setting_enabled: [ OK ] 4.60 sec.
2025-06-04 01:10:39 03258_old_analyzer_const_expr_bug: [ OK ] 1.29 sec.
2025-06-04 01:10:40 03208_inconsistent_formatting_of_not_subquery: [ OK ] 1.61 sec.
2025-06-04 01:10:42 02481_default_value_used_in_row_level_filter: [ OK ] 1.97 sec.
2025-06-04 01:10:45 01893_jit_aggregation_function_min_long: [ OK ] 6.93 sec.
2025-06-04 01:10:47 00999_nullable_nested_types_4877: [ OK ] 4.25 sec.
2025-06-04 01:10:47 01011_test_create_as_skip_indices: [ OK ] 2.23 sec.
2025-06-04 01:10:50 01825_new_type_json_8: [ OK ] 10.37 sec.
2025-06-04 01:10:50 02967_parallel_replicas_join_algo_and_analyzer_2: [ OK ] 62.21 sec.
2025-06-04 01:10:51 02343_aggregation_pipeline: [ OK ] 3.83 sec.
2025-06-04 01:10:52 01818_case_float_value_fangyc: [ OK ] 0.71 sec.
2025-06-04 01:10:52 02097_initializeAggregationNullable: [ OK ] 1.01 sec.
2025-06-04 01:10:53 01549_low_cardinality_materialized_view: [ OK ] 1.09 sec.
2025-06-04 01:10:53 00818_alias_bug_4110: [ OK ] 3.02 sec.
2025-06-04 01:10:54 01016_macros: [ OK ] 0.90 sec.
2025-06-04 01:10:55 02494_analyzer_compound_expression_crash_fix: [ OK ] 1.06 sec.
2025-06-04 01:10:56 00411_long_accurate_number_comparison_int1: [ OK ] 129.18 sec.
2025-06-04 01:10:56 01458_named_tuple_millin: [ OK ] 0.96 sec.
2025-06-04 01:10:56 02973_parse_crlf_with_tsv_files: [ OK ] 4.26 sec.
2025-06-04 01:10:56 03037_dynamic_merges_1_horizontal_compact_wide_tree: [ SKIPPED ] 0.00 sec.
2025-06-04 01:10:56 Reason: not running for current build
2025-06-04 01:10:56 03207_json_read_subcolumns_1_wide_merge_tree: [ OK ] 35.64 sec.
2025-06-04 01:10:56 02024_compression_in_query: [ OK ] 9.05 sec.
2025-06-04 01:10:56 01880_remote_ipv6: [ OK ] 3.26 sec.
2025-06-04 01:10:57 01720_engine_file_empty_if_not_exists: [ OK ] 0.99 sec.
2025-06-04 01:10:57 00490_special_line_separators_and_characters_outside_of_bmp: [ OK ] 0.96 sec.
2025-06-04 01:10:58 03161_ipv4_ipv6_equality: [ OK ] 1.10 sec.
2025-06-04 01:10:58 02985_if_over_big_int_decimal: [ OK ] 1.71 sec.
2025-06-04 01:10:58 00368_format_option_collision: [ OK ] 2.15 sec.
2025-06-04 01:10:58 02456_aggregate_state_conversion: [ OK ] 0.75 sec.
2025-06-04 01:10:59 01120_join_constants: [ OK ] 1.00 sec.
2025-06-04 01:10:59 03001_bad_error_message_higher_order_functions: [ OK ] 2.80 sec.
2025-06-04 01:10:59 00460_vertical_and_totals_extremes: [ OK ] 1.15 sec.
2025-06-04 01:10:59 02734_sparse_columns_short_circuit: [ OK ] 1.25 sec.
2025-06-04 01:11:00 01657_test_toHour_mysql_compatibility: [ OK ] 0.80 sec.
2025-06-04 01:11:00 02359_send_logs_source_regexp: [ OK ] 2.15 sec.
2025-06-04 01:11:00 02811_invalid_embedded_rocksdb_create: [ OK ] 1.05 sec.
2025-06-04 01:11:00 02006_client_test_hint_error_name: [ OK ] 0.60 sec.
2025-06-04 01:11:01 01087_index_set_ubsan: [ OK ] 0.86 sec.
2025-06-04 01:11:01 01284_view_and_extremes_bug: [ OK ] 0.95 sec.
2025-06-04 01:11:02 02771_tsv_csv_custom_skip_trailing_empty_lines: [ OK ] 2.45 sec.
2025-06-04 01:11:02 01083_aggregation_memory_efficient_bug: [ OK ] 2.07 sec.
2025-06-04 01:11:03 00844_join_lightee2: [ OK ] 1.20 sec.
2025-06-04 01:11:03 02968_full_sorting_join_fuzz: [ OK ] 30.07 sec.
2025-06-04 01:11:03 03084_analyzer_join_column_alias: [ OK ] 1.15 sec.
2025-06-04 01:11:04 02269_to_start_of_interval_overflow: [ OK ] 1.36 sec.
2025-06-04 01:11:05 00980_zookeeper_merge_tree_alter_settings: [ OK ] 6.21 sec.
2025-06-04 01:11:05 01416_clear_column_pk: [ OK ] 1.60 sec.
2025-06-04 01:11:07 01050_engine_join_view_crash: [ OK ] 1.55 sec.
2025-06-04 01:11:07 02122_parallel_formatting_Markdown: [ OK ] 5.82 sec.
2025-06-04 01:11:07 03012_parser_backtracking: [ OK ] 30.21 sec.
2025-06-04 01:11:08 01656_ipv4_bad_formatting: [ OK ] 0.75 sec.
2025-06-04 01:11:08 03003_functions_to_subcolumns_final: [ OK ] 1.60 sec.
2025-06-04 01:11:08 01592_length_map: [ OK ] 1.01 sec.
2025-06-04 01:11:08 02361_fsync_profile_events: [ OK ] 5.61 sec.
2025-06-04 01:11:09 01774_tuple_null_in: [ OK ] 0.90 sec.
2025-06-04 01:11:10 01710_minmax_count_projection_distributed_query: [ OK ] 1.11 sec.
2025-06-04 01:11:11 01661_test_toDayOfWeek_mysql_compatibility: [ OK ] 0.80 sec.
2025-06-04 01:11:11 00678_shard_funnel_window: [ OK ] 2.32 sec.
2025-06-04 01:11:11 03130_analyzer_self_join_group_by: [ OK ] 1.46 sec.
2025-06-04 01:11:12 01471_with_format: [ OK ] 0.80 sec.
2025-06-04 01:11:13 00484_preferred_max_column_in_block_size_bytes: [ OK ] 10.12 sec.
2025-06-04 01:11:13 03036_schema_inference_cache_s3_archives: [ OK ] 1.31 sec.
2025-06-04 01:11:14 01451_replicated_detach_drop_and_quorum_long: [ OK ] 3.15 sec.
2025-06-04 01:11:14 01477_lc_in_merge_join_left_key: [ OK ] 6.02 sec.
2025-06-04 01:11:14 01014_count_of_merges_metrics: [ OK ] 1.42 sec.
2025-06-04 01:11:15 00981_no_virtual_columns: [ OK ] 1.10 sec.
2025-06-04 01:11:15 02355_control_block_size_in_array_join: [ OK ] 1.31 sec.
2025-06-04 01:11:16 02304_grouping_set_order_by: [ OK ] 0.85 sec.
2025-06-04 01:11:16 00623_in_partition_key: [ OK ] 5.31 sec.
2025-06-04 01:11:16 00276_sample: [ OK ] 11.04 sec.
2025-06-04 01:11:19 00732_quorum_insert_lost_part_zookeeper_long: [ OK ] 3.02 sec.
2025-06-04 01:11:20 00055_join_two_numbers: [ OK ] 0.95 sec.
2025-06-04 01:11:20 02702_allow_skip_errors_enum: [ OK ] 3.97 sec.
2025-06-04 01:11:20 02177_issue_31009: [ SKIPPED ] 0.00 sec.
2025-06-04 01:11:20 Reason: not running for current build
2025-06-04 01:11:21 00113_shard_group_array: [ OK ] 23.77 sec.
2025-06-04 01:11:22 00151_tuple_with_array: [ OK ] 0.80 sec.
2025-06-04 01:11:23 01460_line_as_string_format: [ OK ] 20.21 sec.
2025-06-04 01:11:24 01544_file_engine_settings: [ OK ] 3.31 sec.
2025-06-04 01:11:25 01483_merge_table_join_and_group_by: [ OK ] 2.56 sec.
2025-06-04 01:11:25 02696_ignore_inacc_tables_mat_view_atttach: [ OK ] 1.24 sec.
2025-06-04 01:11:26 00800_low_cardinality_merge_join: [ OK ] 10.58 sec.
2025-06-04 01:11:27 02514_tsv_zero_started_number: [ OK ] 0.86 sec.
2025-06-04 01:11:27 02481_low_cardinality_with_short_circuit_functins: [ OK ] 1.90 sec.
2025-06-04 01:11:27 02157_readonly_system_suspend: [ OK ] 2.45 sec.
2025-06-04 01:11:28 00594_alias_in_distributed: [ OK ] 4.39 sec.
2025-06-04 01:11:28 02355_column_type_name_lc: [ OK ] 0.85 sec.
2025-06-04 01:11:30 00950_test_gorilla_codec: [ OK ] 1.96 sec.
2025-06-04 01:11:30 01528_to_uuid_or_null_or_zero: [ OK ] 2.70 sec.
2025-06-04 01:11:31 01280_null_in: [ OK ] 1.18 sec.
2025-06-04 01:11:31 03064_analyzer_named_subqueries: [ OK ] 0.81 sec.
2025-06-04 01:11:32 02815_first_line: [ OK ] 1.10 sec.
2025-06-04 01:11:32 00351_select_distinct_arrays_tuples: [ OK ] 1.10 sec.
2025-06-04 01:11:34 02835_join_step_explain: [ OK ] 1.35 sec.
2025-06-04 01:11:35 02874_analysis_of_variance_overflow: [ OK ] 1.05 sec.
2025-06-04 01:11:35 03036_test_parquet_bloom_filter_push_down: [ OK ] 20.97 sec.
2025-06-04 01:11:36 00717_merge_and_distributed: [ OK ] 8.18 sec.
2025-06-04 01:11:37 02206_format_override: [ OK ] 4.51 sec.
2025-06-04 01:11:37 02376_analyzer_in_function_subquery: [ OK ] 2.06 sec.
2025-06-04 01:11:38 01085_simdjson_uint64: [ OK ] 0.70 sec.
2025-06-04 01:11:39 00952_basic_constraints: [ OK ] 11.75 sec.
2025-06-04 01:11:42 02122_parallel_formatting_CustomSeparated: [ OK ] 6.82 sec.
2025-06-04 01:11:42 01581_deduplicate_by_columns_local: [ OK ] 5.72 sec.
2025-06-04 01:11:42 01156_pcg_deserialization: [ OK ] 25.86 sec.
2025-06-04 01:11:43 02515_analyzer_null_for_empty: [ OK ] 0.86 sec.
2025-06-04 01:11:44 03251_unaligned_window_function_state: [ OK ] 1.31 sec.
2025-06-04 01:11:44 01412_group_array_moving_shard: [ OK ] 5.22 sec.
2025-06-04 01:11:44 02680_datetime64_monotonic_check: [ OK ] 1.47 sec.
2025-06-04 01:11:44 02346_fulltext_index_search: [ OK ] 24.21 sec.
2025-06-04 01:11:48 02900_matview_create_to_errors: [ OK ] 3.58 sec.
2025-06-04 01:11:48 01825_type_json_7: [ OK ] 5.51 sec.
2025-06-04 01:11:48 00431_if_nulls: [ OK ] 9.92 sec.
2025-06-04 01:11:49 02714_date_date32_in: [ OK ] 0.95 sec.
2025-06-04 01:11:51 03020_output_format_client: [ OK ] 7.01 sec.
2025-06-04 01:11:51 02206_clickhouse_local_use_database: [ OK ] 2.30 sec.
2025-06-04 01:11:51 00753_alter_destination_for_storage_buffer: [ OK ] 2.15 sec.
2025-06-04 01:11:51 02718_cli_dashed_options_parsing: [ OK ] 6.82 sec.
2025-06-04 01:11:51 01058_window_view_event_hop_to_strict_asc: [ OK ] 6.92 sec.
2025-06-04 01:11:52 02311_range_hashed_dictionary_range_cast: [ OK ] 1.16 sec.
2025-06-04 01:11:52 00568_empty_function_with_fixed_string: [ OK ] 1.06 sec.
2025-06-04 01:11:53 02967_index_hint_crash: [ OK ] 1.05 sec.
2025-06-04 01:11:53 01199_url_functions_path_without_schema_yiurule: [ OK ] 0.75 sec.
2025-06-04 01:11:53 03046_column_in_block_array_join: [ OK ] 1.30 sec.
2025-06-04 01:11:54 01605_key_condition_enum_int: [ OK ] 1.06 sec.
2025-06-04 01:11:54 01430_fix_any_rewrite_aliases: [ OK ] 0.85 sec.
2025-06-04 01:11:55 01096_block_serialized_state: [ OK ] 0.80 sec.
2025-06-04 01:11:55 03208_array_of_json_read_subcolumns_2_memory: [ SKIPPED ] 0.00 sec.
2025-06-04 01:11:55 Reason: not running for current build
2025-06-04 01:11:55 02165_h3_edge_length_km: [ OK ] 1.42 sec.
2025-06-04 01:11:55 00426_nulls_sorting: [ OK ] 1.81 sec.
2025-06-04 01:11:56 02315_pmj_union_ubsan_35857: [ OK ] 0.96 sec.
2025-06-04 01:11:57 03199_fix_auc_tie_handling: [ OK ] 1.36 sec.
2025-06-04 01:11:57 02381_analyzer_join_final: [ OK ] 1.56 sec.
2025-06-04 01:11:57 01017_uniqCombined_memory_usage: [ SKIPPED ] 0.00 sec.
2025-06-04 01:11:57 Reason: not running for current build
2025-06-04 01:11:58 01085_extract_all_empty: [ OK ] 0.80 sec.
2025-06-04 01:11:59 01791_dist_INSERT_block_structure_mismatch: [ OK ] 2.76 sec.
2025-06-04 01:12:00 02433_default_expression_operator_in: [ OK ] 2.21 sec.
2025-06-04 01:12:00 01710_projection_in_set: [ OK ] 1.70 sec.
2025-06-04 01:12:01 02915_lazy_loading_of_base_backups: [ OK ] 10.48 sec.
2025-06-04 01:12:01 01825_new_type_json_3: [ OK ] 4.76 sec.
2025-06-04 01:12:02 00362_great_circle_distance: [ OK ] 1.05 sec.
2025-06-04 01:12:03 01605_drop_settings_profile_while_assigned: [ OK ] 1.00 sec.
2025-06-04 01:12:03 00662_has_nullable: [ OK ] 1.60 sec.
2025-06-04 01:12:04 01663_test_toDate_mysql_compatibility: [ OK ] 0.71 sec.
2025-06-04 01:12:04 00550_join_insert_select: [ OK ] 3.71 sec.
2025-06-04 01:12:05 01293_show_settings: [ OK ] 0.75 sec.
2025-06-04 01:12:05 03035_dynamic_sorting: [ OK ] 2.36 sec.
2025-06-04 01:12:05 01881_join_on_conditions_hash: [ OK ] 13.88 sec.
2025-06-04 01:12:06 03036_reading_s3_archives: [ OK ] 4.41 sec.
2025-06-04 01:12:07 01825_type_json_ghdata: [ OK ] 18.79 sec.
2025-06-04 01:12:07 01710_projection_drop_if_exists: [ OK ] 1.66 sec.
2025-06-04 01:12:08 00752_low_cardinality_lambda_argument: [ OK ] 1.46 sec.
2025-06-04 01:12:08 01019_materialized_view_select_extra_columns: [ OK ] 1.76 sec.
2025-06-04 01:12:09 00607_index_in_in: [ OK ] 1.55 sec.
2025-06-04 01:12:09 02457_morton_coding: [ OK ] 4.21 sec.
2025-06-04 01:12:10 02125_constant_if_condition_and_not_existing_column: [ OK ] 1.36 sec.
2025-06-04 01:12:10 00752_low_cardinality_permute: [ OK ] 1.00 sec.
2025-06-04 01:12:11 03095_join_filter_push_down_right_stream_filled: [ OK ] 1.26 sec.
2025-06-04 01:12:12 03169_modify_column_data_loss: [ OK ] 1.51 sec.
2025-06-04 01:12:12 02751_multiquery_with_argument: [ OK ] 8.17 sec.
2025-06-04 01:12:12 00974_fix_join_on: [ OK ] 4.28 sec.
2025-06-04 01:12:12 00627_recursive_alias: [ OK ] 0.80 sec.
2025-06-04 01:12:13 00900_null_array_orc_load: [ OK ] 4.36 sec.
2025-06-04 01:12:13 03095_msan_uuid_string_to_num: [ OK ] 1.45 sec.
2025-06-04 01:12:14 02946_literal_alias_misclassification: [ OK ] 1.26 sec.
2025-06-04 01:12:14 02476_fuse_sum_count: [ OK ] 2.45 sec.
2025-06-04 01:12:14 01773_min_max_time_system_parts_datetime64: [ OK ] 1.10 sec.
2025-06-04 01:12:14 00515_enhanced_time_zones: [ OK ] 9.33 sec.
2025-06-04 01:12:15 02591_bson_long_tuple: [ OK ] 0.64 sec.
2025-06-04 01:12:15 01044_h3_edge_angle: [ OK ] 0.86 sec.
2025-06-04 01:12:16 00118_storage_join: [ OK ] 2.15 sec.
2025-06-04 01:12:16 01010_pm_join_all_join_bug: [ OK ] 1.76 sec.
2025-06-04 01:12:16 00346_if_tuple: [ OK ] 1.26 sec.
2025-06-04 01:12:17 00234_disjunctive_equality_chains_optimization: [ OK ] 0.91 sec.
2025-06-04 01:12:17 00508_materialized_view_to: [ OK ] 1.50 sec.
2025-06-04 01:12:17 02971_functions_to_subcolumns_map: [ OK ] 1.25 sec.
2025-06-04 01:12:18 02294_decimal_second_errors: [ OK ] 1.01 sec.
2025-06-04 01:12:18 02735_array_map_array_of_tuples: [ OK ] 1.05 sec.
2025-06-04 01:12:19 01009_global_array_join_names: [ OK ] 1.15 sec.
2025-06-04 01:12:19 01047_simple_aggregate_sizes_of_columns_bug: [ OK ] 2.15 sec.
2025-06-04 01:12:20 00679_uuid_in_key: [ OK ] 1.51 sec.
2025-06-04 01:12:20 01678_great_circle_angle: [ OK ] 1.38 sec.
2025-06-04 01:12:22 02158_ztest: [ OK ] 1.11 sec.
2025-06-04 01:12:22 02458_datediff_date32: [ OK ] 4.81 sec.
2025-06-04 01:12:22 02918_multif_for_nullable: [ OK ] 4.56 sec.
2025-06-04 01:12:24 02817_structure_to_schema: [ OK ] 47.24 sec.
2025-06-04 01:12:25 00927_asof_join_noninclusive: [ OK ] 2.39 sec.
2025-06-04 01:12:25 02916_replication_protocol_wait_for_part: [ OK ] 11.77 sec.
2025-06-04 01:12:26 01894_jit_aggregation_function_max_long: [ OK ] 3.71 sec.
2025-06-04 01:12:26 01927_query_views_log_current_database: [ OK ] 5.46 sec.
2025-06-04 01:12:26 02260_alter_compact_part_drop_nested_column: [ OK ] 2.15 sec.
2025-06-04 01:12:28 02306_rowbinary_has_no_bom: [ OK ] 1.90 sec.
2025-06-04 01:12:29 01039_row_policy_dcl: [ OK ] 2.45 sec.
2025-06-04 01:12:29 02337_join_analyze_stuck: [ OK ] 3.52 sec.
2025-06-04 01:12:30 01851_clear_column_referenced_by_mv: [ OK ] 1.55 sec.
2025-06-04 01:12:30 00826_cross_to_inner_join: [ OK ] 4.86 sec.
2025-06-04 01:12:31 00751_low_cardinality_nullable_group_by: [ OK ] 5.81 sec.
2025-06-04 01:12:31 02129_window_functions_disable_optimizations: [ OK ] 1.36 sec.
2025-06-04 01:12:32 03261_json_hints_types_check: [ OK ] 3.31 sec.
2025-06-04 01:12:32 00667_compare_arrays_of_different_types: [ OK ] 0.94 sec.
2025-06-04 01:12:32 02366_kql_create_table: [ OK ] 1.60 sec.
2025-06-04 01:12:33 03305_compressed_memory_eng_crash_reading_subcolumn: [ OK ] 0.90 sec.
2025-06-04 01:12:35 02353_translate: [ OK ] 2.71 sec.
2025-06-04 01:12:37 02246_is_secure_query_log: [ OK ] 15.34 sec.
2025-06-04 01:12:39 02903_client_insert_in_background: [ OK ] 3.75 sec.
2025-06-04 01:12:39 00853_join_with_nulls_crash: [ OK ] 2.21 sec.
2025-06-04 01:12:45 01825_type_json_13: [ OK ] 5.96 sec.
2025-06-04 01:12:46 02255_broken_parts_chain_on_start: [ OK ] 15.39 sec.
2025-06-04 01:12:46 01289_min_execution_speed_not_too_early: [ OK ] 6.77 sec.
2025-06-04 01:12:46 00090_union_race_conditions_1: [ OK ] 92.81 sec.
2025-06-04 01:12:47 01069_materialized_view_alter_target_table: [ OK ] 1.56 sec.
2025-06-04 01:12:48 02045_like_function: [ OK ] 0.86 sec.
2025-06-04 01:12:49 01445_create_table_as_table_function: [ OK ] 3.15 sec.
2025-06-04 01:12:50 00538_datediff: [ OK ] 3.91 sec.
2025-06-04 01:12:50 03262_analyzer_materialized_view_in_with_cte: [ OK ] 1.26 sec.
2025-06-04 01:12:51 02935_format_with_arbitrary_types: [ OK ] 4.76 sec.
2025-06-04 01:12:52 01398_in_tuple_func: [ OK ] 1.41 sec.
2025-06-04 01:12:53 01631_date_overflow_as_partition_key: [ OK ] 1.05 sec.
2025-06-04 01:12:55 00183_skip_unavailable_shards: [ OK ] 25.08 sec.
2025-06-04 01:12:56 01283_max_threads_simple_query_optimization: [ OK ] 3.22 sec.
2025-06-04 01:12:56 02161_addressToLineWithInlines: [ SKIPPED ] 0.00 sec.
2025-06-04 01:12:56 Reason: not running for current build
2025-06-04 01:12:57 01846_alter_column_without_type_bugfix: [ OK ] 1.06 sec.
2025-06-04 01:12:59 00497_whitespaces_in_insert: [ OK ] 11.30 sec.
2025-06-04 01:13:00 00500_point_in_polygon: [ OK ] 4.21 sec.
2025-06-04 01:13:00 02918_implicit_sign_column_constraints_for_collapsing_engine: [ OK ] 9.26 sec.
2025-06-04 01:13:01 01326_build_id: [ OK ] 0.75 sec.
2025-06-04 01:13:01 02154_bit_slice_for_fixedstring: [ OK ] 9.47 sec.
2025-06-04 01:13:05 00653_verification_monotonic_data_load: [ OK ] 32.04 sec.
2025-06-04 01:13:05 01346_alter_enum_partition_key_replicated_zookeeper_long: [ OK ] 5.91 sec.
2025-06-04 01:13:06 02422_read_numbers_as_strings: [ OK ] 0.86 sec.
2025-06-04 01:13:07 03221_merge_profile_events: [ OK ] 9.80 sec.
2025-06-04 01:13:08 01035_prewhere_with_alias: [ OK ] 1.21 sec.
2025-06-04 01:13:09 01188_attach_table_from_path: [ OK ] 2.30 sec.
2025-06-04 01:13:13 02457_parse_date_time_best_effort: [ OK ] 4.11 sec.
2025-06-04 01:13:15 02439_merge_selecting_partitions: [ OK ] 10.42 sec.
2025-06-04 01:13:16 02421_json_decimals_as_strings: [ OK ] 0.90 sec.
2025-06-04 01:13:18 03224_json_merges_new_type_in_shared_data: [ OK ] 1.82 sec.
2025-06-04 01:13:20 02801_backup_native_copy: [ OK ] 19.21 sec.
2025-06-04 01:13:20 02380_insert_mv_race: [ OK ] 19.25 sec.
2025-06-04 01:13:23 01419_merge_tree_settings_sanity_check: [ OK ] 3.25 sec.
2025-06-04 01:13:23 02354_read_in_order_prewhere: [ OK ] 10.34 sec.
2025-06-04 01:13:24 02226_low_cardinality_text_bloom_filter_index: [ OK ] 4.37 sec.
2025-06-04 01:13:26 01034_unknown_qualified_column_in_join: [ OK ] 2.15 sec.
2025-06-04 01:13:26 02842_filesystem_cache_validate_path: [ OK ] 1.65 sec.
2025-06-04 01:13:28 00361_shared_array_offsets_and_squash_blocks: [ OK ] 1.60 sec.
2025-06-04 01:13:28 02861_alter_replace_partition_do_not_wait_mutations_on_unrelated_partitions: [ OK ] 10.05 sec.
2025-06-04 01:13:29 03198_unload_primary_key_outdated: [ OK ] 5.01 sec.
2025-06-04 01:13:30 02346_position_countsubstrings_zero_byte: [ OK ] 2.05 sec.
2025-06-04 01:13:31 02366_kql_func_math: [ OK ] 2.50 sec.
2025-06-04 01:13:35 02876_yyyymmddtodate: [ OK ] 9.78 sec.
2025-06-04 01:13:36 02521_incorrect_dealy_for_insert_bug_44902: [ OK ] 27.43 sec.
2025-06-04 01:13:37 02832_transform_fixed_string_no_default: [ OK ] 0.95 sec.
2025-06-04 01:13:37 01825_type_json_15: [ OK ] 5.97 sec.
2025-06-04 01:13:38 02963_single_value_destructor: [ OK ] 2.16 sec.
2025-06-04 01:13:42 02941_projections_external_aggregation: [ OK ] 5.13 sec.
2025-06-04 01:13:42 02021_map_bloom_filter_index: [ OK ] 5.27 sec.
2025-06-04 01:13:43 02811_csv_input_field_type_mismatch: [ OK ] 4.66 sec.
2025-06-04 01:13:45 01076_json_each_row_array: [ OK ] 2.96 sec.
2025-06-04 01:13:45 00340_squashing_insert_select: [ OK ] 14.54 sec.
2025-06-04 01:13:46 02310_generate_multi_columns_with_uuid: [ OK ] 0.90 sec.
2025-06-04 01:13:46 01056_predicate_optimizer_bugs: [ OK ] 4.41 sec.
2025-06-04 01:13:47 02148_cast_type_parsing: [ OK ] 0.76 sec.
2025-06-04 01:13:47 01030_limit_by_with_ties_error: [ OK ] 4.05 sec.
2025-06-04 01:13:48 01903_http_fields: [ OK ] 3.27 sec.
2025-06-04 01:13:49 02568_json_array_length: [ OK ] 2.06 sec.
2025-06-04 01:13:49 02491_part_log_has_table_uuid: [ OK ] 2.87 sec.
2025-06-04 01:13:49 03037_dynamic_merges_2_horizontal_wide_merge_tree: [ SKIPPED ] 0.00 sec.
2025-06-04 01:13:49 Reason: not running for current build
2025-06-04 01:13:49 02815_alias_to_length: [ OK ] 1.00 sec.
2025-06-04 01:13:50 00726_length_aliases: [ OK ] 0.81 sec.
2025-06-04 01:13:51 01773_datetime64_add_ubsan: [ OK ] 1.30 sec.
2025-06-04 01:13:52 01548_create_table_compound_column_format: [ OK ] 1.60 sec.
2025-06-04 01:13:52 02882_primary_key_index_in_function_different_types: [ OK ] 1.70 sec.
2025-06-04 01:13:55 02135_local_create_db: [ OK ] 2.65 sec.
2025-06-04 01:13:55 01882_check_max_parts_to_merge_at_once: [ OK ] 5.21 sec.
2025-06-04 01:13:55 01271_show_privileges: [ OK ] 0.75 sec.
2025-06-04 01:13:56 00217_shard_global_subquery_columns_with_same_name: [ OK ] 1.30 sec.
2025-06-04 01:13:57 02456_bloom_filter_assert: [ OK ] 4.51 sec.
2025-06-04 01:13:58 02354_with_statement_non_exist_column: [ OK ] 0.95 sec.
2025-06-04 01:13:58 01508_query_obfuscator: [ OK ] 2.05 sec.
2025-06-04 01:14:00 03206_no_exceptions_clickhouse_local: [ FAIL ] 2.01 sec.
2025-06-04 01:14:00 Reason: return code: 134, result:
2025-06-04 01:14:00
2025-06-04 01:14:00
2025-06-04 01:14:00
2025-06-04 01:14:00 stdout:
2025-06-04 01:14:00
2025-06-04 01:14:00
2025-06-04 01:14:00 Settings used in the test: --max_insert_threads 3 --group_by_two_level_threshold 49039 --group_by_two_level_threshold_bytes 36130996 --distributed_aggregation_memory_efficient 0 --fsync_metadata 1 --output_format_parallel_formatting 0 --input_format_parallel_parsing 1 --min_chunk_bytes_for_parallel_parsing 7669527 --max_read_buffer_size 675305 --prefer_localhost_replica 0 --max_block_size 51684 --max_joined_block_size_rows 99082 --max_threads 1 --optimize_append_index 1 --optimize_if_chain_to_multiif 1 --optimize_if_transform_strings_to_enum 0 --optimize_read_in_order 1 --optimize_or_like_chain 1 --optimize_substitute_columns 0 --enable_multiple_prewhere_read_steps 1 --read_in_order_two_level_merge_threshold 83 --optimize_aggregation_in_order 0 --aggregation_in_order_max_block_bytes 6654028 --use_uncompressed_cache 1 --min_bytes_to_use_direct_io 1 --min_bytes_to_use_mmap_io 1304441411 --local_filesystem_read_method read --remote_filesystem_read_method threadpool --local_filesystem_read_prefetch 1 --filesystem_cache_segments_batch_size 3 --read_from_filesystem_cache_if_exists_otherwise_bypass_cache 1 --throw_on_error_from_cache_on_write_operations 0 --remote_filesystem_read_prefetch 1 --allow_prefetched_read_pool_for_remote_filesystem 1 --filesystem_prefetch_max_memory_usage 32Mi --filesystem_prefetches_limit 0 --filesystem_prefetch_min_bytes_for_single_read_task 8Mi --filesystem_prefetch_step_marks 0 --filesystem_prefetch_step_bytes 0 --compile_aggregate_expressions 0 --compile_sort_description 1 --merge_tree_coarse_index_granularity 9 --optimize_distinct_in_order 0 --max_bytes_before_external_sort 0 --max_bytes_before_external_group_by 5722341220 --max_bytes_before_remerge_sort 2029804045 --min_compress_block_size 595806 --max_compress_block_size 1167613 --merge_tree_compact_parts_min_granules_to_multibuffer_read 9 --optimize_sorting_by_input_stream_properties 0 --http_response_buffer_size 2977537 --http_wait_end_of_query False --enable_memory_bound_merging_of_aggregation_results 0 --min_count_to_compile_expression 0 --min_count_to_compile_aggregate_expression 3 --min_count_to_compile_sort_description 0 --session_timezone Mexico/BajaSur --use_page_cache_for_disks_without_file_cache False --page_cache_inject_eviction True --merge_tree_read_split_ranges_into_intersecting_and_non_intersecting_injection_probability 0.34 --prefer_external_sort_block_bytes 0 --cross_join_min_rows_to_compress 1 --cross_join_min_bytes_to_compress 1 --min_external_table_block_size_bytes 100000000 --max_parsing_threads 10 --optimize_functions_to_subcolumns 1 --parallel_replicas_local_plan 1
2025-06-04 01:14:00
2025-06-04 01:14:00 MergeTree settings used in test: --ratio_of_defaults_for_sparse_serialization 1.0 --prefer_fetch_merged_part_size_threshold 10737418240 --vertical_merge_algorithm_min_rows_to_activate 1 --vertical_merge_algorithm_min_columns_to_activate 85 --allow_vertical_merges_from_compact_to_wide_parts 1 --min_merge_bytes_to_use_direct_io 10737418240 --index_granularity_bytes 31246544 --merge_max_block_size 17041 --index_granularity 48617 --min_bytes_for_wide_part 1073741824 --marks_compress_block_size 17188 --primary_key_compress_block_size 18142 --replace_long_file_name_to_hash 0 --max_file_name_length 128 --min_bytes_for_full_part_storage 0 --compact_parts_max_bytes_to_buffer 100658452 --compact_parts_max_granules_to_buffer 48 --compact_parts_merge_max_bytes_to_prefetch_part 12993117 --cache_populated_by_fetch 0 --concurrent_part_removal_threshold 0 --old_parts_lifetime 265
2025-06-04 01:14:00
2025-06-04 01:14:00 Database: test_n3w0npc2
2025-06-04 01:14:01 01268_mv_scalars: [ OK ] 3.05 sec.
2025-06-04 01:14:01 00482_subqueries_and_aliases: [ OK ] 1.25 sec.
2025-06-04 01:14:02 01663_quantile_weighted_overflow: [ OK ] 0.85 sec.
2025-06-04 01:14:02 02906_flatten_only_true_nested: [ OK ] 1.01 sec.
2025-06-04 01:14:03 01081_demangle: [ OK ] 0.85 sec.
2025-06-04 01:14:04 00746_hashing_tuples: [ OK ] 1.90 sec.
2025-06-04 01:14:04 02734_big_int_from_float_ubsan: [ OK ] 0.90 sec.
2025-06-04 01:14:05 02473_multistep_prewhere: [ OK ] 92.88 sec.
2025-06-04 01:14:05 00700_decimal_defaults: [ OK ] 1.06 sec.
2025-06-04 01:14:06 00443_optimize_final_vertical_merge: [ OK ] 19.65 sec.
2025-06-04 01:14:07 02000_table_function_cluster_macros: [ OK ] 1.27 sec.
2025-06-04 01:14:07 01621_clickhouse_compressor: [ OK ] 1.95 sec.
2025-06-04 01:14:08 03094_one_thousand_joins: [ OK ] 67.72 sec.
2025-06-04 01:14:08 01845_add_testcase_for_arrayElement: [ OK ] 1.41 sec.
2025-06-04 01:14:09 00967_insert_into_distributed_different_types: [ OK ] 1.35 sec.
2025-06-04 01:14:09 00753_distributed_system_columns_and_system_tables: [ OK ] 1.45 sec.
2025-06-04 01:14:11 01906_bigint_accurate_cast_ubsan: [ OK ] 4.72 sec.
2025-06-04 01:14:12 02922_respect_nulls_parser: [ OK ] 4.66 sec.
2025-06-04 01:14:12 02242_make_date_mysql: [ OK ] 2.98 sec.
2025-06-04 01:14:13 02461_welch_t_test_fuzz: [ OK ] 1.05 sec.
2025-06-04 01:14:14 00910_decimal_group_array_crash_3783: [ OK ] 2.25 sec.
2025-06-04 01:14:15 00335_bom: [ OK ] 1.85 sec.
2025-06-04 01:14:16 02346_into_outfile_and_stdout: [ OK ] 6.32 sec.
2025-06-04 01:14:17 01866_datetime64_cmp_with_constant: [ OK ] 3.06 sec.
2025-06-04 01:14:18 01753_optimize_aggregation_in_order: [ OK ] 2.70 sec.
2025-06-04 01:14:18 03048_not_found_column_xxx_in_block: [ OK ] 1.30 sec.
2025-06-04 01:14:19 02746_index_analysis_binary_operator_with_null: [ OK ] 1.10 sec.
2025-06-04 01:14:19 01922_array_join_with_index: [ OK ] 0.95 sec.
2025-06-04 01:14:19 02357_query_cancellation_race: [ OK ] 7.77 sec.
2025-06-04 01:14:20 02387_parse_date_as_datetime: [ OK ] 1.21 sec.
2025-06-04 01:14:20 02911_add_index_and_materialize_index: [ OK ] 0.90 sec.
2025-06-04 01:14:25 01600_remerge_sort_lowered_memory_bytes_ratio: [ OK ] 4.96 sec.
2025-06-04 01:14:27 00738_lock_for_inner_table: [ OK ] 6.41 sec.
2025-06-04 01:14:27 02493_analyzer_sum_if_to_count_if: [ OK ] 1.45 sec.
2025-06-04 01:14:28 00926_adaptive_index_granularity_merge_tree: [ OK ] 12.44 sec.
2025-06-04 01:14:29 00610_materialized_view_forward_alter_partition_statements: [ OK ] 1.45 sec.
2025-06-04 01:14:29 01339_client_unrecognized_option: [ OK ] 2.41 sec.
2025-06-04 01:14:29 02504_parse_datetime_best_effort_calebeaires: [ OK ] 0.85 sec.
2025-06-04 01:14:30 00612_http_max_query_size_for_distributed: [ OK ] 1.26 sec.
2025-06-04 01:14:31 02245_s3_schema_desc: [ OK ] 1.91 sec.
2025-06-04 01:14:32 02561_temporary_table_grants: [ OK ] 12.48 sec.
2025-06-04 01:14:33 01259_combinator_distinct: [ OK ] 1.70 sec.
2025-06-04 01:14:34 01246_extractAllGroupsVertical: [ OK ] 4.10 sec.
2025-06-04 01:14:36 02477_age: [ OK ] 4.12 sec.
2025-06-04 01:14:37 01547_query_log_current_database: [ OK ] 2.81 sec.
2025-06-04 01:14:38 01079_bit_operations_using_bitset: [ OK ] 1.66 sec.
2025-06-04 01:14:38 02191_parse_date_time_best_effort_more_cases: [ OK ] 1.15 sec.
2025-06-04 01:14:40 02982_parallel_replicas_unexpected_cluster: [ OK ] 1.46 sec.
2025-06-04 01:14:40 02864_statistics_delayed_materialization_in_merge: [ OK ] 1.86 sec.
2025-06-04 01:14:42 02952_clickhouse_local_query_parameters_cli: [ OK ] 2.05 sec.
2025-06-04 01:14:45 02477_analyzer_array_join_with_join: [ OK ] 5.36 sec.
2025-06-04 01:14:47 00059_shard_global_in: [ OK ] 1.25 sec.
2025-06-04 01:14:47 02864_statistics_predicates: [ OK ] 13.98 sec.
2025-06-04 01:14:48 02122_parallel_formatting_RowBinaryWithNames: [ OK ] 5.67 sec.
2025-06-04 01:14:48 00358_from_string_complex_types: [ OK ] 0.85 sec.
2025-06-04 01:14:49 02534_join_prewhere_bug: [ OK ] 1.86 sec.
2025-06-04 01:14:52 00712_prewhere_with_alias: [ OK ] 2.96 sec.
2025-06-04 01:14:53 02899_distributed_limit_by: [ OK ] 6.52 sec.
2025-06-04 01:14:53 00007_array: [ OK ] 0.90 sec.
2025-06-04 01:14:54 02243_make_date32: [ OK ] 5.61 sec.
2025-06-04 01:14:56 01680_date_time_add_ubsan: [ OK ] 2.30 sec.
2025-06-04 01:14:56 01581_deduplicate_by_columns_replicated_long: [ OK ] 2.97 sec.
2025-06-04 01:14:57 03155_datasketches_ubsan: [ OK ] 0.80 sec.
2025-06-04 01:14:58 02233_optimize_aggregation_in_order_prefix: [ OK ] 2.16 sec.
2025-06-04 01:14:59 01721_join_implicit_cast_long: [ OK ] 54.44 sec.
2025-06-04 01:15:00 02394_every_profile_event_must_have_documentation: [ OK ] 0.75 sec.
2025-06-04 01:15:00 02862_sorted_distinct_sparse_fix: [ OK ] 1.57 sec.
2025-06-04 01:15:01 02809_has_token: [ OK ] 0.76 sec.
2025-06-04 01:15:02 01073_bad_alter_partition: [ OK ] 2.31 sec.
2025-06-04 01:15:03 02122_parallel_formatting_JSONCompactEachRowWithNames: [ OK ] 6.12 sec.
2025-06-04 01:15:04 01123_parse_date_time_best_effort_even_more: [ OK ] 0.85 sec.
2025-06-04 01:15:04 02136_kill_scalar_queries: [ OK ] 2.97 sec.
2025-06-04 01:15:04 03165_storage_merge_view_prewhere: [ OK ] 2.12 sec.
2025-06-04 01:15:05 02096_totals_global_in_bug: [ OK ] 1.25 sec.
2025-06-04 01:15:07 01526_param_uuid: [ OK ] 2.23 sec.
2025-06-04 01:15:08 02302_clash_const_aggegate_join: [ OK ] 2.16 sec.
2025-06-04 01:15:08 00180_attach_materialized_view: [ OK ] 1.02 sec.
2025-06-04 01:15:08 02366_kql_func_ip: [ OK ] 14.20 sec.
2025-06-04 01:15:09 00072_in_types: [ OK ] 0.96 sec.
2025-06-04 01:15:11 02895_npy_format: [ OK ] 41.31 sec.
2025-06-04 01:15:12 01414_freeze_does_not_prevent_alters: [ OK ] 2.35 sec.
2025-06-04 01:15:12 02956_rocksdb_with_ttl: [ OK ] 4.06 sec.
2025-06-04 01:15:12 02962_analyzer_constant_set: [ OK ] 1.20 sec.
2025-06-04 01:15:13 00685_output_format_json_escape_forward_slashes: [ OK ] 0.91 sec.
2025-06-04 01:15:13 02999_scalar_subqueries_bug_2: [ OK ] 1.21 sec.
2025-06-04 01:15:14 02967_analyzer_fuzz: [ OK ] 1.51 sec.
2025-06-04 01:15:14 01493_table_function_null: [ OK ] 0.80 sec.
2025-06-04 01:15:14 02950_parallel_replicas_used_count: [ OK ] 9.97 sec.
2025-06-04 01:15:14 02458_empty_hdfs_url: [ OK ] 1.25 sec.
2025-06-04 01:15:14 02128_apply_lambda_parsing: [ OK ] 0.85 sec.
2025-06-04 01:15:15 02884_string_distance_function: [ OK ] 6.82 sec.
2025-06-04 01:15:15 02416_json_tuple_to_array_schema_inference: [ OK ] 0.79 sec.
2025-06-04 01:15:15 02306_window_move_row_number_fix: [ OK ] 0.75 sec.
2025-06-04 01:15:16 00939_limit_by_offset: [ OK ] 1.16 sec.
2025-06-04 01:15:16 00191_aggregating_merge_tree_and_final: [ OK ] 1.65 sec.
2025-06-04 01:15:16 01881_to_week_monotonic_fix: [ OK ] 1.21 sec.
2025-06-04 01:15:17 01013_totals_without_aggregation: [ OK ] 1.35 sec.
2025-06-04 01:15:18 01358_mutation_delete_null_rows: [ OK ] 1.72 sec.
2025-06-04 01:15:18 02782_avro_decimals: [ OK ] 2.65 sec.
2025-06-04 01:15:18 00910_buffer_prewhere: [ OK ] 1.00 sec.
2025-06-04 01:15:19 02513_broken_datetime64_init_on_mac: [ OK ] 0.75 sec.
2025-06-04 01:15:21 02515_aggregate_functions_statistics: [ OK ] 2.81 sec.
2025-06-04 01:15:21 02842_largestTriangleThreeBuckets_aggregate_function: [ OK ] 2.55 sec.
2025-06-04 01:15:22 01115_join_with_dictionary: [ OK ] 6.41 sec.
2025-06-04 01:15:23 02465_limit_trivial_max_rows_to_read: [ OK ] 1.75 sec.
2025-06-04 01:15:24 02011_normalize_utf8: [ OK ] 4.58 sec.
2025-06-04 01:15:24 02375_pretty_formats: [ OK ] 2.11 sec.
2025-06-04 01:15:25 00097_long_storage_buffer_race_condition: [ OK ] 116.39 sec.
2025-06-04 01:15:26 02540_date_column_consistent_insert_behaviour: [ OK ] 4.96 sec.
2025-06-04 01:15:26 00177_inserts_through_http_parts: [ OK ] 1.95 sec.
2025-06-04 01:15:27 00188_constants_as_arguments_of_aggregate_functions: [ OK ] 0.80 sec.
2025-06-04 01:15:28 01035_avg: [ OK ] 13.19 sec.
2025-06-04 01:15:30 02975_intdiv_with_decimal: [ OK ] 4.40 sec.
2025-06-04 01:15:30 02950_part_log_bytes_uncompressed: [ OK ] 3.11 sec.
2025-06-04 01:15:30 01072_drop_temporary_table_with_same_name: [ OK ] 1.65 sec.
2025-06-04 01:15:30 01276_alter_rename_column_materialized_expr: [ OK ] 3.15 sec.
2025-06-04 01:15:31 01492_array_join_crash_13829: [ OK ] 0.75 sec.
2025-06-04 01:15:32 01410_nullable_key_and_index_negate_cond: [ OK ] 2.35 sec.
2025-06-04 01:15:33 00353_join_by_tuple: [ OK ] 0.92 sec.
2025-06-04 01:15:35 02270_errors_in_files: [ OK ] 12.33 sec.
2025-06-04 01:15:36 03210_nested_short_circuit_functions_bug: [ OK ] 1.02 sec.
2025-06-04 01:15:37 01943_query_id_check: [ OK ] 7.06 sec.
2025-06-04 01:15:37 00477_parsing_data_types: [ OK ] 0.61 sec.
2025-06-04 01:15:37 01273_arrow_arrays_load: [ OK ] 6.21 sec.
2025-06-04 01:15:37 00700_to_decimal_or_something_1: [ OK ] 13.84 sec.
2025-06-04 01:15:38 01551_mergetree_read_in_order_spread: [ OK ] 1.61 sec.
2025-06-04 01:15:39 02136_scalar_progress: [ OK ] 1.70 sec.
2025-06-04 01:15:40 02186_range_hashed_dictionary_intersecting_intervals: [ OK ] 2.05 sec.
2025-06-04 01:15:40 01521_format_readable_time_delta2: [ OK ] 2.67 sec.
2025-06-04 01:15:40 00914_replicate: [ OK ] 0.80 sec.
2025-06-04 01:15:41 02733_sparse_columns_reload: [ OK ] 1.65 sec.
2025-06-04 01:15:42 01278_variance_nonnegative: [ OK ] 1.86 sec.
2025-06-04 01:15:43 01600_min_max_compress_block_size: [ OK ] 1.10 sec.
2025-06-04 01:15:43 03152_trailing_comma_in_columns_list_in_insert: [ OK ] 0.85 sec.
2025-06-04 01:15:44 03006_join_on_inequal_expression_2: [ OK ] 11.19 sec.
2025-06-04 01:15:45 03043_group_array_result_is_expected: [ OK ] 1.05 sec.
2025-06-04 01:15:45 01012_select_limit_x_0: [ OK ] 0.80 sec.
2025-06-04 01:15:46 01301_polygons_within: [ OK ] 1.60 sec.
2025-06-04 01:15:47 00002_system_numbers: [ OK ] 1.82 sec.
2025-06-04 01:15:47 02317_distinct_in_order_optimization: [ OK ] 9.02 sec.
2025-06-04 01:15:48 02366_kql_distinct: [ OK ] 1.40 sec.
2025-06-04 01:15:48 01453_normalize_query_alias_uuid: [ OK ] 0.71 sec.
2025-06-04 01:15:48 01769_extended_range_2: [ OK ] 1.16 sec.
2025-06-04 01:15:49 00925_zookeeper_empty_replicated_merge_tree_optimize_final_long: [ OK ] 6.82 sec.
2025-06-04 01:15:49 00606_quantiles_and_nans: [ OK ] 0.90 sec.
2025-06-04 01:15:50 02474_timeDiff_UTCTimestamp: [ OK ] 1.25 sec.
2025-06-04 01:15:50 03208_array_of_json_read_subcolumns_2_compact_merge_tree: [ SKIPPED ] 0.00 sec.
2025-06-04 01:15:50 Reason: not running for current build
2025-06-04 01:15:50 00321_pk_set: [ OK ] 1.95 sec.
2025-06-04 01:15:51 03215_parallel_replicas_crash_after_refactoring: [ OK ] 2.56 sec.
2025-06-04 01:15:51 03196_max_intersections_arena_crash: [ OK ] 1.08 sec.
2025-06-04 01:15:52 01244_optimize_distributed_group_by_sharding_key: [ OK ] 11.68 sec.
2025-06-04 01:15:52 02889_print_pretty_type_names: [ OK ] 0.91 sec.
2025-06-04 01:15:52 02771_ignore_data_skipping_indices: [ OK ] 2.91 sec.
2025-06-04 01:15:53 02888_obsolete_settings: [ OK ] 1.20 sec.
2025-06-04 01:15:54 00754_alter_modify_column_partitions: [ OK ] 3.74 sec.
2025-06-04 01:15:54 01750_parsing_exception: [ OK ] 2.95 sec.
2025-06-04 01:15:54 02180_group_by_lowcardinality: [ OK ] 1.00 sec.
2025-06-04 01:15:55 02319_dict_get_check_arguments_size: [ OK ] 3.11 sec.
2025-06-04 01:15:56 00024_unused_array_join_in_subquery: [ OK ] 0.71 sec.
2025-06-04 01:15:56 00030_alter_table: [ OK ] 3.87 sec.
2025-06-04 01:15:56 02915_sleep_large_uint: [ OK ] 2.66 sec.
2025-06-04 01:15:57 02141_clickhouse_local_interactive_table: [ OK ] 2.75 sec.
2025-06-04 01:15:57 01525_select_with_offset_fetch_clause: [ OK ] 1.26 sec.
2025-06-04 01:15:58 00453_cast_enum: [ OK ] 1.44 sec.
2025-06-04 01:15:58 01852_s2_get_neighbours: [ OK ] 0.70 sec.
2025-06-04 01:15:58 02813_func_today_and_alias: [ OK ] 1.11 sec.
2025-06-04 01:15:58 02026_accurate_cast_or_default: [ OK ] 3.76 sec.
2025-06-04 01:16:00 02971_limit_by_distributed: [ OK ] 1.60 sec.
2025-06-04 01:16:00 00507_array_no_params: [ OK ] 3.82 sec.
2025-06-04 01:16:02 02974_analyzer_array_join_subcolumn: [ OK ] 1.96 sec.
2025-06-04 01:16:02 00165_transform_non_const_default: [ OK ] 1.65 sec.
2025-06-04 01:16:03 01795_TinyLog_rwlock_ub: [ OK ] 1.05 sec.
2025-06-04 01:16:03 01714_alter_drop_version: [ OK ] 1.21 sec.
2025-06-04 01:16:04 03313_case_insensitive_json_type_declaration: [ OK ] 0.61 sec.
2025-06-04 01:16:05 01456_low_cardinality_sorting_bugfix: [ OK ] 1.90 sec.
2025-06-04 01:16:06 03120_analyzer_param_in_CTE_alias: [ OK ] 1.00 sec.
2025-06-04 01:16:07 00064_negate_bug: [ OK ] 0.76 sec.
2025-06-04 01:16:07 02534_parquet_fixed_binary_array: [ OK ] 8.97 sec.
2025-06-04 01:16:08 00700_decimal_aggregates: [ OK ] 10.37 sec.
2025-06-04 01:16:10 01413_alter_update_supertype: [ OK ] 1.35 sec.
2025-06-04 01:16:10 00926_zookeeper_adaptive_index_granularity_replicated_merge_tree_long: [ OK ] 11.49 sec.
2025-06-04 01:16:11 01272_offset_without_limit: [ OK ] 1.10 sec.
2025-06-04 01:16:11 03031_clickhouse_local_input: [ OK ] 4.16 sec.
2025-06-04 01:16:12 01600_encode_XML: [ OK ] 1.00 sec.
2025-06-04 01:16:12 01523_client_local_queries_file_parameter: [ OK ] 4.86 sec.
2025-06-04 01:16:13 02317_functions_with_nothing: [ OK ] 1.30 sec.
2025-06-04 01:16:14 00908_bloom_filter_index: [ OK ] 43.95 sec.
2025-06-04 01:16:15 02559_multiple_read_steps_in_prewhere_fuzz: [ OK ] 1.15 sec.
2025-06-04 01:16:16 02875_show_functions: [ OK ] 3.77 sec.
2025-06-04 01:16:16 02896_leading_zeroes_no_octal: [ OK ] 11.89 sec.
2025-06-04 01:16:16 02675_sparse_columns_clear_column: [ OK ] 5.09 sec.
2025-06-04 01:16:17 00328_long_case_construction: [ OK ] 244.00 sec.
2025-06-04 01:16:17 02267_output_format_prometheus: [ OK ] 1.36 sec.
2025-06-04 01:16:17 02293_h3_hex_ring: [ OK ] 3.82 sec.
2025-06-04 01:16:18 01892_setting_limit_offset_distributed: [ OK ] 2.20 sec.
2025-06-04 01:16:18 01118_is_constant: [ OK ] 1.46 sec.
2025-06-04 01:16:19 02481_i43247_ubsan_in_minmaxany: [ OK ] 2.42 sec.
2025-06-04 01:16:19 01276_system_licenses: [ OK ] 1.02 sec.
2025-06-04 01:16:19 02233_with_total_empty_chunk: [ OK ] 1.15 sec.
2025-06-04 01:16:20 02594_msgpack_more_types: [ OK ] 3.01 sec.
2025-06-04 01:16:20 01662_test_toDayOfMonth_mysql_compatibility: [ OK ] 0.90 sec.
2025-06-04 01:16:20 02680_default_star: [ OK ] 0.61 sec.
2025-06-04 01:16:20 00230_array_functions_has_count_equal_index_of_non_const_second_arg: [ OK ] 3.06 sec.
2025-06-04 01:16:22 02429_combinators_in_array_reduce: [ OK ] 1.16 sec.
2025-06-04 01:16:22 02789_functions_after_sorting_and_columns_with_same_names_bug_2: [ OK ] 1.47 sec.
2025-06-04 01:16:22 00730_unicode_terminal_format: [ OK ] 1.77 sec.
2025-06-04 01:16:23 02155_parse_date_lowcard_default_throw: [ OK ] 0.71 sec.
2025-06-04 01:16:23 02908_Npy_files_caching: [ OK ] 6.61 sec.
2025-06-04 01:16:23 01521_alter_enum_and_reverse_read: [ OK ] 1.33 sec.
2025-06-04 01:16:24 00969_roundDuration: [ OK ] 1.56 sec.
2025-06-04 01:16:25 03062_analyzer_join_engine_missing_column: [ OK ] 1.31 sec.
2025-06-04 01:16:26 00060_date_lut: [ OK ] 0.76 sec.
2025-06-04 01:16:28 01710_projections_partial_optimize_aggregation_in_order: [ OK ] 17.80 sec.
2025-06-04 01:16:29 00953_constraints_operations: [ OK ] 9.27 sec.
2025-06-04 01:16:29 03040_dynamic_type_alters_1_wide_merge_tree: [ OK ] 6.12 sec.
2025-06-04 01:16:30 02225_hints_for_indeices: [ OK ] 5.91 sec.
2025-06-04 01:16:30 01889_check_row_policy_defined_using_user_function: [ OK ] 11.48 sec.
2025-06-04 01:16:30 01259_datetime64_ubsan: [ OK ] 1.46 sec.
2025-06-04 01:16:30 02267_empty_arrays_read_reverse: [ OK ] 4.68 sec.
2025-06-04 01:16:31 03140_client_subsequent_external_tables: [ OK ] 2.30 sec.
2025-06-04 01:16:32 02960_alter_table_part_query_parameter: [ OK ] 1.25 sec.
2025-06-04 01:16:32 02201_use_skip_indexes_if_final: [ OK ] 1.56 sec.
2025-06-04 01:16:33 02968_mysql_prefer_column_name_to_alias: [ OK ] 1.76 sec.
2025-06-04 01:16:33 03073_analyzer_alias_as_column_name: [ OK ] 1.15 sec.
2025-06-04 01:16:34 02503_in_lc_const_args_bug: [ OK ] 0.80 sec.
2025-06-04 01:16:34 02015_async_inserts_4: [ OK ] 11.57 sec.
2025-06-04 01:16:34 03042_not_found_column_c1: [ OK ] 1.05 sec.
2025-06-04 01:16:36 02891_alter_update_adaptive_granularity: [ OK ] 1.36 sec.
2025-06-04 01:16:38 02581_width_bucket: [ OK ] 7.37 sec.
2025-06-04 01:16:38 02313_test_fpc_codec: [ OK ] 3.41 sec.
2025-06-04 01:16:38 00251_has_types: [ OK ] 1.77 sec.
2025-06-04 01:16:38 03237_max_map_state_decimal_serialization: [ OK ] 0.76 sec.
2025-06-04 01:16:38 01531_query_log_query_comment: [ OK ] 3.87 sec.
2025-06-04 01:16:39 00552_logical_functions_uint8_as_bool: [ OK ] 0.91 sec.
2025-06-04 01:16:39 03001_backup_matview_after_modify_query: [ OK ] 7.72 sec.
2025-06-04 01:16:39 00502_string_concat_with_array: [ OK ] 0.91 sec.
2025-06-04 01:16:39 01358_constexpr_constraint: [ OK ] 0.90 sec.
2025-06-04 01:16:40 02508_index_analysis_to_date_timezone: [ OK ] 1.42 sec.
2025-06-04 01:16:41 00876_wrong_arraj_join_column: [ OK ] 1.01 sec.
2025-06-04 01:16:41 00661_array_has_silviucpp: [ OK ] 1.05 sec.
2025-06-04 01:16:41 00968_roundAge: [ OK ] 1.11 sec.
2025-06-04 01:16:42 00686_client_exit_code: [ OK ] 1.95 sec.
2025-06-04 01:16:42 02788_current_schemas_function: [ OK ] 1.67 sec.
2025-06-04 01:16:44 02293_h3_line: [ OK ] 2.97 sec.
2025-06-04 01:16:44 02495_concat_with_separator: [ OK ] 6.17 sec.
2025-06-04 01:16:45 03262_column_sizes_with_dynamic_structure: [ OK ] 14.63 sec.
2025-06-04 01:16:45 02879_use_structure_from_insertion_table_with_defaults: [ OK ] 2.81 sec.
2025-06-04 01:16:46 02316_hierarchical_dictionaries_nullable_parent_key: [ OK ] 5.51 sec.
2025-06-04 01:16:46 00647_histogram: [ OK ] 1.41 sec.
2025-06-04 01:16:47 01785_parallel_formatting_memory: [ OK ] 4.73 sec.
2025-06-04 01:16:49 02688_aggregate_states: [ OK ] 5.02 sec.
2025-06-04 01:16:49 02950_reading_array_tuple_subcolumns: [ OK ] 2.71 sec.
2025-06-04 01:16:50 02345_analyzer_subqueries: [ OK ] 2.72 sec.
2025-06-04 01:16:50 00392_enum_nested_alter: [ OK ] 4.43 sec.
2025-06-04 01:16:51 02177_merge_optimize_aggregation_in_order: [ OK ] 1.66 sec.
2025-06-04 01:16:51 03325_distributed_join_json_array_subcolumns: [ OK ] 1.72 sec.
2025-06-04 01:16:52 01115_prewhere_array_join: [ OK ] 2.51 sec.
2025-06-04 01:16:52 01882_scalar_subquery_exception: [ OK ] 1.40 sec.
2025-06-04 01:16:53 01018_Distributed__shard_num: [ OK ] 6.36 sec.
2025-06-04 01:16:54 02294_system_certificates: [ OK ] 0.76 sec.
2025-06-04 01:16:54 02994_sanity_check_settings: [ OK ] 1.20 sec.
2025-06-04 01:16:54 00514_interval_operators: [ OK ] 2.76 sec.
2025-06-04 01:16:55 02525_different_engines_in_temporary_tables: [ OK ] 2.26 sec.
2025-06-04 01:16:55 01413_truncate_without_table_keyword: [ OK ] 1.06 sec.
2025-06-04 01:16:56 00732_quorum_insert_simple_test_2_parts_zookeeper_long: [ OK ] 2.01 sec.
2025-06-04 01:16:57 01050_engine_join_crash: [ OK ] 2.62 sec.
2025-06-04 01:16:58 01825_new_type_json_insert_select: [ OK ] 3.87 sec.
2025-06-04 01:16:59 01072_json_each_row_data_in_square_brackets: [ OK ] 1.05 sec.
2025-06-04 01:16:59 00738_nested_merge_multidimensional_array: [ OK ] 1.40 sec.
2025-06-04 01:16:59 02870_per_column_settings: [ OK ] 3.26 sec.
2025-06-04 01:17:00 00560_float_leading_plus_in_exponent: [ OK ] 0.85 sec.
2025-06-04 01:17:00 00712_prewhere_with_final: [ OK ] 1.46 sec.
2025-06-04 01:17:02 02538_analyzer_create_table_as_select: [ OK ] 1.25 sec.
2025-06-04 01:17:02 01691_parser_data_type_exponential: [ OK ] 6.76 sec.
2025-06-04 01:17:03 02354_vector_search_legacy_index_compatibility: [ OK ] 2.82 sec.
2025-06-04 01:17:04 02366_window_function_order_by: [ OK ] 1.01 sec.
2025-06-04 01:17:05 01821_join_table_mutation: [ OK ] 2.15 sec.
2025-06-04 01:17:06 00339_parsing_bad_arrays: [ OK ] 1.75 sec.
2025-06-04 01:17:06 02812_pointwise_array_operations: [ OK ] 3.96 sec.
2025-06-04 01:17:07 00445_join_nullable_keys: [ OK ] 1.45 sec.
2025-06-04 01:17:09 02882_formatQuery: [ OK ] 4.31 sec.
2025-06-04 01:17:11 02496_row_binary_large_string_size: [ OK ] 3.70 sec.
2025-06-04 01:17:12 03008_deduplication_insert_into_partitioned_table: [ OK ] 5.71 sec.
2025-06-04 01:17:12 00950_bad_alloc_when_truncate_join_storage: [ OK ] 0.75 sec.
2025-06-04 01:17:14 00459_group_array_insert_at: [ OK ] 1.70 sec.
2025-06-04 01:17:15 03237_get_subcolumn_low_cardinality_column: [ OK ] 0.75 sec.
2025-06-04 01:17:16 01062_pm_all_join_with_block_continuation: [ OK ] 48.12 sec.
2025-06-04 01:17:17 01812_optimize_skip_unused_shards_single_node: [ OK ] 0.90 sec.
2025-06-04 01:17:17 02016_bit_shift_right_for_string_integer: [ OK ] 8.17 sec.
2025-06-04 01:17:18 01122_totals_rollup_having_block_header: [ OK ] 1.11 sec.
2025-06-04 01:17:18 01060_window_view_event_tumble_to_asc: [ OK ] 7.06 sec.
2025-06-04 01:17:18 02902_select_subcolumns_from_engine_null: [ OK ] 1.01 sec.
2025-06-04 01:17:19 01380_nullable_state: [ OK ] 4.21 sec.
2025-06-04 01:17:19 02354_numeric_literals_with_underscores: [ OK ] 1.05 sec.
2025-06-04 01:17:20 01831_max_streams: [ OK ] 0.91 sec.
2025-06-04 01:17:21 03130_convert_outer_join_to_inner_join: [ OK ] 2.25 sec.
2025-06-04 01:17:21 02592_avro_more_types: [ OK ] 2.82 sec.
2025-06-04 01:17:21 03208_numbers_total_rows_approx: [ OK ] 0.71 sec.
2025-06-04 01:17:22 00499_json_enum_insert: [ OK ] 1.16 sec.
2025-06-04 01:17:23 01055_prewhere_bugs: [ OK ] 1.77 sec.
2025-06-04 01:17:23 01666_lcm_ubsan: [ OK ] 3.97 sec.
2025-06-04 01:17:24 01256_misspell_layout_name_podshumok: [ OK ] 1.05 sec.
2025-06-04 01:17:25 00743_limit_by_not_found_column: [ OK ] 1.40 sec.
2025-06-04 01:17:26 02429_low_cardinality_trash: [ OK ] 1.95 sec.
2025-06-04 01:17:26 00938_dataset_test: [ OK ] 1.32 sec.
2025-06-04 01:17:27 02129_add_column_add_ttl: [ OK ] 3.46 sec.
2025-06-04 01:17:28 02004_intersect_except_distinct_operators: [ OK ] 6.92 sec.
2025-06-04 01:17:28 01273_arrow_stream: [ OK ] 44.04 sec.
2025-06-04 01:17:28 02860_distributed_flush_on_detach: [ OK ] 1.70 sec.
2025-06-04 01:17:29 01359_codeql: [ OK ] 0.76 sec.
2025-06-04 01:17:29 02972_to_string_nullable_timezone: [ OK ] 0.85 sec.
2025-06-04 01:17:30 02731_replace_partition_from_temporary_table: [ OK ] 4.22 sec.
2025-06-04 01:17:30 02480_tets_show_full: [ OK ] 3.31 sec.
2025-06-04 01:17:30 01702_rewrite_avg_for_algebraic_optimization: [ OK ] 1.80 sec.
2025-06-04 01:17:31 02893_bad_sample_view: [ OK ] 1.01 sec.
2025-06-04 01:17:31 02723_jit_aggregation_bug_48120: [ SKIPPED ] 0.00 sec.
2025-06-04 01:17:31 Reason: not running for current build
2025-06-04 01:17:32 00293_shard_max_subquery_depth: [ OK ] 2.12 sec.
2025-06-04 01:17:34 00821_distributed_storage_with_join_on: [ OK ] 2.16 sec.
2025-06-04 01:17:34 02124_insert_deduplication_token_replica: [ OK ] 3.86 sec.
2025-06-04 01:17:35 00974_full_outer_join: [ OK ] 0.91 sec.
2025-06-04 01:17:35 01562_agg_null_for_empty_ahead: [ OK ] 2.77 sec.
2025-06-04 01:17:36 00263_merge_aggregates_and_overflow: [ OK ] 1.15 sec.
2025-06-04 01:17:36 02317_distinct_in_order_optimization_explain: [ OK ] 36.94 sec.
2025-06-04 01:17:36 02033_join_engine_deadlock_long: [ OK ] 7.61 sec.
2025-06-04 01:17:37 01623_byte_size_const: [ OK ] 0.91 sec.
2025-06-04 01:17:37 01428_hash_set_nan_key: [ OK ] 1.30 sec.
2025-06-04 01:17:38 03142_skip_ANSI_in_UTF8_compute_width: [ OK ] 0.85 sec.
2025-06-04 01:17:39 02737_sql_auto_is_null: [ OK ] 0.80 sec.
2025-06-04 01:17:40 01505_trivial_count_with_partition_predicate: [ OK ] 3.58 sec.
2025-06-04 01:17:41 02494_array_function_range: [ OK ] 1.35 sec.
2025-06-04 01:17:41 02461_alter_update_respect_part_column_type_bug: [ OK ] 7.33 sec.
2025-06-04 01:17:42 00972_geohashesInBox: [ OK ] 6.82 sec.
2025-06-04 01:17:42 00389_concat_operator: [ OK ] 0.81 sec.
2025-06-04 01:17:43 02922_respect_nulls_Nullable: [ OK ] 3.41 sec.
2025-06-04 01:17:44 01404_roundUpToPowerOfTwoOrZero_safety: [ OK ] 1.31 sec.
2025-06-04 01:17:45 03033_final_undefined_last_mark: [ OK ] 0.75 sec.
2025-06-04 01:17:46 02721_url_cluster: [ OK ] 3.47 sec.
2025-06-04 01:17:46 01651_group_uniq_array_enum: [ OK ] 1.06 sec.
2025-06-04 01:17:46 00626_replace_partition_from_table: [ OK ] 4.46 sec.
2025-06-04 01:17:47 02280_add_query_level_settings: [ OK ] 1.17 sec.
2025-06-04 01:17:48 01137_sample_final: [ OK ] 1.50 sec.
2025-06-04 01:17:48 02498_storage_join_key_positions: [ OK ] 11.13 sec.
2025-06-04 01:17:48 02475_or_function_alias_and_const_where: [ OK ] 0.97 sec.
2025-06-04 01:17:49 00169_join_constant_keys: [ OK ] 0.85 sec.
2025-06-04 01:17:50 01104_distributed_numbers_test: [ OK ] 2.00 sec.
2025-06-04 01:17:50 01049_join_low_card_bug_long: [ OK ] 61.02 sec.
2025-06-04 01:17:51 01077_mutations_index_consistency: [ OK ] 9.13 sec.
2025-06-04 01:17:51 02412_nlp: [ OK ] 1.55 sec.
2025-06-04 01:17:51 02876_json_incomplete_types_as_strings_inference: [ OK ] 0.90 sec.
2025-06-04 01:17:51 02265_per_table_ttl_mutation_on_change: [ OK ] 2.96 sec.
2025-06-04 01:17:52 01047_no_alias_columns_with_table_aliases: [ OK ] 1.46 sec.
2025-06-04 01:17:52 03016_analyzer_groupby_fuzz_59796: [ OK ] 0.86 sec.
2025-06-04 01:17:52 01423_if_nullable_cond: [ OK ] 0.77 sec.
2025-06-04 01:17:52 02346_fulltext_index_bug47393: [ OK ] 1.47 sec.
2025-06-04 01:17:53 01232_untuple: [ OK ] 1.81 sec.
2025-06-04 01:17:53 01671_aggregate_function_group_bitmap_data: [ OK ] 1.35 sec.
2025-06-04 01:17:55 03107_ill_formed_select_in_materialized_view: [ OK ] 1.65 sec.
2025-06-04 01:17:56 01010_partial_merge_join_const_and_lc: [ OK ] 2.20 sec.
2025-06-04 01:17:56 01312_case_insensitive_regexp: [ OK ] 1.10 sec.
2025-06-04 01:17:56 03032_storage_memory_modify_settings: [ OK ] 4.67 sec.
2025-06-04 01:17:57 03013_group_by_use_nulls_with_materialize_and_analyzer: [ OK ] 1.31 sec.
2025-06-04 01:17:57 00271_agg_state_and_totals: [ OK ] 0.91 sec.
2025-06-04 01:17:58 01882_total_rows_approx: [ OK ] 5.59 sec.
2025-06-04 01:17:58 02831_trash: [ OK ] 0.85 sec.
2025-06-04 01:17:58 02843_date_predicate_optimizations_bugs: [ OK ] 0.85 sec.
2025-06-04 01:17:59 02240_get_type_serialization_streams: [ OK ] 1.11 sec.
2025-06-04 01:18:00 03039_unknown_identifier_window_function: [ OK ] 1.10 sec.
2025-06-04 01:18:01 01890_state_of_state: [ OK ] 4.91 sec.
2025-06-04 01:18:02 01125_dict_ddl_cannot_add_column: [ OK ] 1.17 sec.
2025-06-04 01:18:03 00449_filter_array_nullable_tuple: [ OK ] 1.55 sec.
2025-06-04 01:18:03 00100_subquery_table_identifier: [ OK ] 5.11 sec.
2025-06-04 01:18:05 01802_formatDateTime_DateTime64_century: [ OK ] 1.41 sec.
2025-06-04 01:18:06 00348_tuples: [ OK ] 2.36 sec.
2025-06-04 01:18:06 02504_disallow_arrayjoin_in_mutations: [ OK ] 1.40 sec.
2025-06-04 01:18:07 01020_having_without_group_by: [ OK ] 0.76 sec.
2025-06-04 01:18:08 01825_new_type_json_9: [ OK ] 1.31 sec.
2025-06-04 01:18:08 02372_analyzer_join: [ OK ] 39.40 sec.
2025-06-04 01:18:09 01951_distributed_push_down_limit: [ OK ] 1.20 sec.
2025-06-04 01:18:10 02953_slow_create_view: [ OK ] 1.35 sec.
2025-06-04 01:18:12 02013_zlib_read_after_eof: [ OK ] 4.77 sec.
2025-06-04 01:18:12 00628_in_lambda_on_merge_table_bug: [ OK ] 2.07 sec.
2025-06-04 01:18:12 03013_repeat_with_nonnative_integers: [ OK ] 0.90 sec.
2025-06-04 01:18:13 01504_rocksdb: [ OK ] 14.39 sec.
2025-06-04 01:18:13 03079_analyzer_numeric_literals_as_column_names: [ OK ] 0.99 sec.
2025-06-04 01:18:13 02989_variant_comparison: [ OK ] 4.16 sec.
2025-06-04 01:18:14 00337_shard_any_heavy: [ OK ] 1.05 sec.
2025-06-04 01:18:14 02789_jit_cannot_convert_column: [ OK ] 1.00 sec.
2025-06-04 01:18:16 02932_query_settings_max_size_drop: [ OK ] 3.25 sec.
2025-06-04 01:18:16 03217_primary_index_memory_leak: [ SKIPPED ] 0.00 sec.
2025-06-04 01:18:16 Reason: not running for current build
2025-06-04 01:18:17 00978_ml_math: [ OK ] 0.80 sec.
2025-06-04 01:18:18 01411_xor_itai_shirav: [ OK ] 0.75 sec.
2025-06-04 01:18:18 01956_skip_unavailable_shards_excessive_attempts: [ OK ] 4.36 sec.
2025-06-04 01:18:20 01395_limit_more_cases: [ OK ] 264.40 sec.
2025-06-04 01:18:21 01825_new_type_json_in_array: [ OK ] 3.22 sec.
2025-06-04 01:18:21 03158_dynamic_type_from_variant: [ OK ] 1.20 sec.
2025-06-04 01:18:21 03156_group_concat: [ OK ] 7.32 sec.
2025-06-04 01:18:22 01825_type_json_3: [ OK ] 4.41 sec.
2025-06-04 01:18:23 00338_replicate_array_of_strings: [ OK ] 1.30 sec.
2025-06-04 01:18:23 02724_persist_interval_type: [ OK ] 1.92 sec.
2025-06-04 01:18:24 00396_uuid: [ OK ] 1.61 sec.
2025-06-04 01:18:24 00218_like_regexp_newline: [ OK ] 1.30 sec.
2025-06-04 01:18:24 01657_array_element_ubsan: [ OK ] 1.50 sec.
2025-06-04 01:18:26 02479_mysql_connect_to_self: [ OK ] 4.32 sec.
2025-06-04 01:18:29 00700_decimal_arithm: [ OK ] 15.74 sec.
2025-06-04 01:18:31 00913_many_threads: [ OK ] 6.72 sec.
2025-06-04 01:18:34 02122_parallel_formatting_Vertical: [ OK ] 8.08 sec.
2025-06-04 01:18:35 00267_tuple_array_access_operators_priority: [ OK ] 0.85 sec.
2025-06-04 01:18:35 02784_parallel_replicas_automatic_decision: [ OK ] 33.85 sec.
2025-06-04 01:18:36 02875_json_array_as_string: [ OK ] 0.80 sec.
2025-06-04 01:18:36 01720_union_distinct_with_limit: [ OK ] 0.82 sec.
2025-06-04 01:18:37 03276_functions_to_subcolumns_lc: [ OK ] 1.05 sec.
2025-06-04 01:18:37 02567_native_type_conversions: [ OK ] 6.12 sec.
2025-06-04 01:18:38 02997_projections_formatting: [ OK ] 0.90 sec.
2025-06-04 01:18:39 01415_sticking_mutations: [ OK ] 52.40 sec.
2025-06-04 01:18:39 02027_ngrams: [ OK ] 3.07 sec.
2025-06-04 01:18:39 03096_largest_triangle_3b_crash: [ OK ] 0.81 sec.
2025-06-04 01:18:40 03203_variant_convert_field_to_type_bug: [ OK ] 1.21 sec.
2025-06-04 01:18:40 00742_require_join_strictness: [ OK ] 1.11 sec.
2025-06-04 01:18:41 03165_distinct_with_window_func_crash: [ OK ] 1.06 sec.
2025-06-04 01:18:42 00135_duplicate_group_by_keys_segfault: [ OK ] 0.76 sec.
2025-06-04 01:18:42 02104_clickhouse_local_columns_description: [ OK ] 2.12 sec.
2025-06-04 01:18:43 01825_type_json_nbagames: [ OK ] 18.36 sec.
2025-06-04 01:18:43 00152_totals_in_subquery: [ OK ] 1.18 sec.
2025-06-04 01:18:45 00085_visible_width_of_tuple_of_dates: [ OK ] 0.91 sec.
2025-06-04 01:18:49 02841_not_ready_set_bug: [ OK ] 11.09 sec.
2025-06-04 01:18:49 03287_dynamic_and_json_squashing_fix: [ OK ] 4.60 sec.
2025-06-04 01:18:52 02560_vertical_merge_memory_usage: [ OK ] 21.93 sec.
2025-06-04 01:18:53 01144_multiple_joins_rewriter_v2_and_lambdas: [ OK ] 4.38 sec.
2025-06-04 01:18:55 02877_optimize_read_in_order_from_view: [ OK ] 11.57 sec.
2025-06-04 01:18:55
2025-06-04 01:18:55 209 tests passed. 1 tests skipped. 1055.77 s elapsed (Process-6).
2025-06-04 01:18:55 02184_ipv6_cast_test: [ OK ] 1.36 sec.
2025-06-04 01:18:55
2025-06-04 01:18:55 197 tests passed. 4 tests skipped. 1055.95 s elapsed (Process-9).
2025-06-04 01:18:56 02900_buffer_table_alter_race: [ OK ] 13.79 sec.
2025-06-04 01:18:56
2025-06-04 01:18:56 237 tests passed. 4 tests skipped. 1057.33 s elapsed (Process-5).
2025-06-04 01:18:56 00723_remerge_sort: [ OK ] 4.21 sec.
2025-06-04 01:18:56
2025-06-04 01:18:56 Having 1 errors! 226 tests passed. 4 tests skipped. 1057.42 s elapsed (Process-4).
2025-06-04 01:18:57 00417_kill_query: [ OK ] 7.64 sec.
2025-06-04 01:18:57
2025-06-04 01:18:57 Having 1 errors! 148 tests passed. 3 tests skipped. 1058.28 s elapsed (Process-8).
2025-06-04 01:18:58 02933_group_by_memory_usage: [ OK ] 18.71 sec.
2025-06-04 01:18:58
2025-06-04 01:18:58 181 tests passed. 0 tests skipped. 1058.94 s elapsed (Process-7).
2025-06-04 01:19:30 01903_correct_block_size_prediction_with_default: [ OK ] 98.06 sec.
2025-06-04 01:19:30
2025-06-04 01:19:30 193 tests passed. 1 tests skipped. 1091.16 s elapsed (Process-3).
2025-06-04 01:19:31 02764_csv_trim_whitespaces: [ OK ] 66.18 sec.
2025-06-04 01:19:31
2025-06-04 01:19:31 194 tests passed. 2 tests skipped. 1091.84 s elapsed (Process-10).
2025-06-04 01:19:36 Running 126 stateless tests (MainProcess).
2025-06-04 01:19:43 03206_replication_lag_metric: [ OK ] 6.94 sec.
2025-06-04 01:19:46 03198_table_function_directory_path: [ OK ] 2.97 sec.
2025-06-04 01:19:48 03147_table_function_loop: [ OK ] 1.87 sec.
2025-06-04 01:24:17 03008_deduplication_several_mv_into_one_table_nonreplicated: [ OK ] 269.02 sec.
2025-06-04 01:28:07 03008_deduplication_insert_several_blocks_nonreplicated: [ OK ] 229.74 sec.
2025-06-04 01:28:18 03002_part_log_rmt_fetch_merge_error: [ OK ] 11.50 sec.
2025-06-04 01:28:25 02973_backup_of_in_memory_compressed: [ OK ] 6.12 sec.
2025-06-04 01:29:29 02962_system_sync_replica_lightweight_from_modifier: [ OK ] 64.07 sec.
2025-06-04 01:29:31 02960_partition_by_udf: [ OK ] 1.37 sec.
2025-06-04 01:29:46 02944_dynamically_change_filesystem_cache_size: [ OK ] 14.96 sec.
2025-06-04 01:29:58 02943_rmt_alter_metadata_merge_checksum_mismatch: [ OK ] 11.94 sec.
2025-06-04 01:30:02 02931_max_num_to_warn: [ OK ] 3.52 sec.
2025-06-04 01:30:10 02916_move_partition_inactive_replica: [ OK ] 7.83 sec.
2025-06-04 01:30:18 02915_move_partition_inactive_replica: [ OK ] 8.19 sec.
2025-06-04 01:30:19 02908_empty_named_collection: [ OK ] 1.01 sec.
2025-06-04 01:30:22 02887_insert_quorum_wo_keeper_retries: [ OK ] 2.91 sec.
2025-06-04 01:30:22 02874_parquet_multiple_batches_array_inconsistent_offsets: [ SKIPPED ] 0.00 sec.
2025-06-04 01:30:22 Reason: not running for current build
2025-06-04 01:30:55 02871_peak_threads_usage: [ OK ] 32.66 sec.
2025-06-04 01:31:20 02845_threads_count_in_distributed_queries: [ OK ] 24.79 sec.
2025-06-04 01:31:33 02789_filesystem_cache_alignment: [ OK ] 13.21 sec.
2025-06-04 01:31:33 02782_uniq_exact_parallel_merging_bug: [ SKIPPED ] 0.00 sec.
2025-06-04 01:31:33 Reason: not running for current build
2025-06-04 01:31:35 02762_replicated_database_no_args: [ OK ] 1.12 sec.
2025-06-04 01:31:37 02735_capnp_case_insensitive_names_matching: [ OK ] 2.06 sec.
2025-06-04 01:33:51 02735_parquet_encoder: [ OK ] 134.37 sec.
2025-06-04 01:34:26 02725_start_stop_fetches: [ OK ] 34.77 sec.
2025-06-04 01:35:20 02700_s3_part_INT_MAX: [ OK ] 53.48 sec.
2025-06-04 01:35:22 02541_arrow_duration_type: [ OK ] 2.71 sec.
2025-06-04 01:36:10 02535_max_parallel_replicas_custom_key_mt: [ OK ] 47.11 sec.
2025-06-04 01:36:12 02522_avro_complicate_schema: [ OK ] 2.71 sec.
2025-06-04 01:36:19 02503_cache_on_write_with_small_segment_size: [ OK ] 6.53 sec.
2025-06-04 01:36:23 02501_deep_recusion_schema_inference: [ OK ] 4.03 sec.
2025-06-04 01:36:36 02497_trace_events_stress_long: [ OK ] 12.60 sec.
2025-06-04 01:36:38 02494_query_cache_user_quotas_after_drop: [ OK ] 1.76 sec.
2025-06-04 01:36:40 02494_query_cache_compression: [ OK ] 1.67 sec.
2025-06-04 01:36:47 02494_query_cache_ttl_long: [ OK ] 7.53 sec.
2025-06-04 01:36:57 02494_trace_log_profile_events: [ OK ] 9.74 sec.
2025-06-04 01:36:59 02494_query_cache_bugs: [ OK ] 1.78 sec.
2025-06-04 01:37:01 02482_json_nested_arrays_with_same_keys: [ OK ] 2.16 sec.
2025-06-04 01:37:04 02458_hdfs_cluster_schema_inference: [ OK ] 2.28 sec.
2025-06-04 01:37:06 02422_msgpack_uuid_wrong_column: [ OK ] 1.72 sec.
2025-06-04 01:37:16 02421_record_errors_row_by_input_format: [ OK ] 10.44 sec.
2025-06-04 01:37:18 02411_merge_tree_zero_max_read_buffer_size: [ OK ] 1.66 sec.
2025-06-04 01:37:23 02404_schema_inference_cache_respect_format_settings: [ OK ] 4.93 sec.
2025-06-04 01:37:23 02396_system_parts_race_condition_rm: [ SKIPPED ] 0.00 sec.
2025-06-04 01:37:23 Reason: disabled
2025-06-04 01:37:26 02373_heap_buffer_overflow_in_avro: [ OK ] 2.92 sec.
2025-06-04 01:37:30 02350_views_max_insert_threads: [ OK ] 3.58 sec.
2025-06-04 01:37:33 02311_system_zookeeper_insert_priv: [ OK ] 3.28 sec.
2025-06-04 01:38:42 02286_mysql_dump_input_format: [ OK ] 68.61 sec.
2025-06-04 01:38:50 02262_column_ttl: [ OK ] 8.23 sec.
2025-06-04 01:38:52 02244_lowcardinality_hash_join: [ OK ] 1.33 sec.
127.0.0.1 - - [04/Jun/2025:08:39:13 +0000] "PUT /devstoreaccount1/cont/twoceovwnczbkyuoojfuhckfojhuflxh HTTP/1.1" 201 -
127.0.0.1 - - [04/Jun/2025:08:39:14 +0000] "PUT /devstoreaccount1/cont/nzeyrdkunobiftlpdmcbnsiqscpshhyj HTTP/1.1" 201 -
127.0.0.1 - - [04/Jun/2025:08:39:14 +0000] "PUT /devstoreaccount1/cont/okjwxuhakcxepctzdgowggrfykrxpkea HTTP/1.1" 201 -
127.0.0.1 - - [04/Jun/2025:08:39:14 +0000] "PUT /devstoreaccount1/cont/pbdggtslywhtqkiawsklvtclhvqyhatq HTTP/1.1" 201 -
127.0.0.1 - - [04/Jun/2025:08:39:14 +0000] "PUT /devstoreaccount1/cont/kgvvawaormolnhlhgvdnkcjlxjvvcjfn HTTP/1.1" 201 -
127.0.0.1 - - [04/Jun/2025:08:39:14 +0000] "PUT /devstoreaccount1/cont/ikmdxndbnsclxrivvnxjhukkcxncsexg HTTP/1.1" 201 -
127.0.0.1 - - [04/Jun/2025:08:39:14 +0000] "PUT /devstoreaccount1/cont/yncsghlhwpxwbkaiareyslcoldygetzy HTTP/1.1" 201 -
127.0.0.1 - - [04/Jun/2025:08:39:14 +0000] "PUT /devstoreaccount1/cont/hpbcktdgjurlfzamdhudrupnwmjggaaa HTTP/1.1" 201 -
127.0.0.1 - - [04/Jun/2025:08:39:14 +0000] "PUT /devstoreaccount1/cont/wzjccldxyudwkvstpqfmhmypwjqhffaz HTTP/1.1" 201 -
127.0.0.1 - - [04/Jun/2025:08:39:14 +0000] "PUT /devstoreaccount1/cont/mypopvpxqqmwnwcobpnwwyfqfmobaeei HTTP/1.1" 201 -
127.0.0.1 - - [04/Jun/2025:08:39:14 +0000] "GET /devstoreaccount1/cont/okjwxuhakcxepctzdgowggrfykrxpkea HTTP/1.1" 206 520
127.0.0.1 - - [04/Jun/2025:08:39:14 +0000] "GET /devstoreaccount1/cont/nzeyrdkunobiftlpdmcbnsiqscpshhyj HTTP/1.1" 206 808111
127.0.0.1 - - [04/Jun/2025:08:39:21 +0000] "DELETE /devstoreaccount1/cont/mypopvpxqqmwnwcobpnwwyfqfmobaeei HTTP/1.1" 202 -
127.0.0.1 - - [04/Jun/2025:08:39:21 +0000] "DELETE /devstoreaccount1/cont/yncsghlhwpxwbkaiareyslcoldygetzy HTTP/1.1" 202 -
127.0.0.1 - - [04/Jun/2025:08:39:21 +0000] "DELETE /devstoreaccount1/cont/kgvvawaormolnhlhgvdnkcjlxjvvcjfn HTTP/1.1" 202 -
127.0.0.1 - - [04/Jun/2025:08:39:21 +0000] "DELETE /devstoreaccount1/cont/nzeyrdkunobiftlpdmcbnsiqscpshhyj HTTP/1.1" 202 -
127.0.0.1 - - [04/Jun/2025:08:39:21 +0000] "DELETE /devstoreaccount1/cont/okjwxuhakcxepctzdgowggrfykrxpkea HTTP/1.1" 202 -
127.0.0.1 - - [04/Jun/2025:08:39:21 +0000] "DELETE /devstoreaccount1/cont/pbdggtslywhtqkiawsklvtclhvqyhatq HTTP/1.1" 202 -
127.0.0.1 - - [04/Jun/2025:08:39:21 +0000] "DELETE /devstoreaccount1/cont/ikmdxndbnsclxrivvnxjhukkcxncsexg HTTP/1.1" 202 -
127.0.0.1 - - [04/Jun/2025:08:39:21 +0000] "DELETE /devstoreaccount1/cont/wzjccldxyudwkvstpqfmhmypwjqhffaz HTTP/1.1" 202 -
127.0.0.1 - - [04/Jun/2025:08:39:21 +0000] "DELETE /devstoreaccount1/cont/hpbcktdgjurlfzamdhudrupnwmjggaaa HTTP/1.1" 202 -
127.0.0.1 - - [04/Jun/2025:08:39:21 +0000] "DELETE /devstoreaccount1/cont/twoceovwnczbkyuoojfuhckfojhuflxh HTTP/1.1" 202 -
2025-06-04 01:39:21 02242_system_filesystem_cache_log_table: [ OK ] 29.16 sec.
2025-06-04 01:39:34 02242_delete_user_race: [ OK ] 13.25 sec.
2025-06-04 01:39:36 02240_filesystem_cache_bypass_cache_threshold: [ OK ] 1.47 sec.
2025-06-04 01:39:38 02240_filesystem_query_cache: [ OK ] 1.62 sec.
127.0.0.1 - - [04/Jun/2025:08:40:04 +0000] "PUT /devstoreaccount1/cont/qssgstdvgdamukagtimwgnatjbkacpbx HTTP/1.1" 201 -
127.0.0.1 - - [04/Jun/2025:08:40:04 +0000] "PUT /devstoreaccount1/cont/nqapilxhjitlfxowezfxelwbgktvsuso HTTP/1.1" 201 -
127.0.0.1 - - [04/Jun/2025:08:40:04 +0000] "PUT /devstoreaccount1/cont/raetdrxjpbgjaepkgfqxuckknfiwrwms HTTP/1.1" 201 -
127.0.0.1 - - [04/Jun/2025:08:40:04 +0000] "PUT /devstoreaccount1/cont/oedaevvaolwoqorccasjukpsnicgsahw HTTP/1.1" 201 -
127.0.0.1 - - [04/Jun/2025:08:40:04 +0000] "PUT /devstoreaccount1/cont/njfumwaqasmrrowacyzayuklorlaesjf HTTP/1.1" 201 -
127.0.0.1 - - [04/Jun/2025:08:40:04 +0000] "PUT /devstoreaccount1/cont/qtndwzkrvctdivmtrbgthjbhvekfmupe HTTP/1.1" 201 -
127.0.0.1 - - [04/Jun/2025:08:40:04 +0000] "PUT /devstoreaccount1/cont/zogxwnexdrdpaogypirjodmccifqtnsa HTTP/1.1" 201 -
127.0.0.1 - - [04/Jun/2025:08:40:04 +0000] "PUT /devstoreaccount1/cont/dvzgmrrrvqzrswybhlkmhdmiviodtner HTTP/1.1" 201 -
127.0.0.1 - - [04/Jun/2025:08:40:04 +0000] "PUT /devstoreaccount1/cont/zentlggahkpqzskpvklmcjypqgngjpac HTTP/1.1" 201 -
127.0.0.1 - - [04/Jun/2025:08:40:04 +0000] "PUT /devstoreaccount1/cont/cjkdttvvrlyxitqsntmfditgdtcfpxxe HTTP/1.1" 201 -
127.0.0.1 - - [04/Jun/2025:08:40:04 +0000] "GET /devstoreaccount1/cont/raetdrxjpbgjaepkgfqxuckknfiwrwms HTTP/1.1" 206 62
127.0.0.1 - - [04/Jun/2025:08:40:04 +0000] "GET /devstoreaccount1/cont/nqapilxhjitlfxowezfxelwbgktvsuso HTTP/1.1" 206 99961
127.0.0.1 - - [04/Jun/2025:08:40:14 +0000] "PUT /devstoreaccount1/cont/ynawzbrzynobouimpptdbkcbxkdjzdvc HTTP/1.1" 201 -
127.0.0.1 - - [04/Jun/2025:08:40:14 +0000] "PUT /devstoreaccount1/cont/djoumuwypyrihzljmfsbkrbjajlzzmeg HTTP/1.1" 201 -
127.0.0.1 - - [04/Jun/2025:08:40:14 +0000] "PUT /devstoreaccount1/cont/ckdayicxarsfsiuurpwlhgbpjlusyqrb HTTP/1.1" 201 -
127.0.0.1 - - [04/Jun/2025:08:40:14 +0000] "PUT /devstoreaccount1/cont/hcctaeorduriqqtapknopcpyrdeddfdu HTTP/1.1" 201 -
127.0.0.1 - - [04/Jun/2025:08:40:14 +0000] "PUT /devstoreaccount1/cont/pvhkarwmfpqinpylzmmpdkjwcugnlcfd HTTP/1.1" 201 -
127.0.0.1 - - [04/Jun/2025:08:40:14 +0000] "DELETE /devstoreaccount1/cont/cjkdttvvrlyxitqsntmfditgdtcfpxxe HTTP/1.1" 202 -
127.0.0.1 - - [04/Jun/2025:08:40:14 +0000] "DELETE /devstoreaccount1/cont/zogxwnexdrdpaogypirjodmccifqtnsa HTTP/1.1" 202 -
127.0.0.1 - - [04/Jun/2025:08:40:14 +0000] "DELETE /devstoreaccount1/cont/njfumwaqasmrrowacyzayuklorlaesjf HTTP/1.1" 202 -
127.0.0.1 - - [04/Jun/2025:08:40:14 +0000] "DELETE /devstoreaccount1/cont/raetdrxjpbgjaepkgfqxuckknfiwrwms HTTP/1.1" 202 -
127.0.0.1 - - [04/Jun/2025:08:40:14 +0000] "DELETE /devstoreaccount1/cont/nqapilxhjitlfxowezfxelwbgktvsuso HTTP/1.1" 202 -
127.0.0.1 - - [04/Jun/2025:08:40:14 +0000] "DELETE /devstoreaccount1/cont/oedaevvaolwoqorccasjukpsnicgsahw HTTP/1.1" 202 -
127.0.0.1 - - [04/Jun/2025:08:40:14 +0000] "DELETE /devstoreaccount1/cont/qtndwzkrvctdivmtrbgthjbhvekfmupe HTTP/1.1" 202 -
127.0.0.1 - - [04/Jun/2025:08:40:14 +0000] "DELETE /devstoreaccount1/cont/zentlggahkpqzskpvklmcjypqgngjpac HTTP/1.1" 202 -
127.0.0.1 - - [04/Jun/2025:08:40:14 +0000] "DELETE /devstoreaccount1/cont/dvzgmrrrvqzrswybhlkmhdmiviodtner HTTP/1.1" 202 -
127.0.0.1 - - [04/Jun/2025:08:40:14 +0000] "PUT /devstoreaccount1/cont/yljfckmlncaxjzdoeisjxyqhzicndnuu HTTP/1.1" 201 -
127.0.0.1 - - [04/Jun/2025:08:40:14 +0000] "PUT /devstoreaccount1/cont/gszfqjfwmatbjwjflkigdvipohzylync HTTP/1.1" 201 -
127.0.0.1 - - [04/Jun/2025:08:40:14 +0000] "PUT /devstoreaccount1/cont/ygwucztvznsrabiojtkaewgubfkvgoyl HTTP/1.1" 201 -
127.0.0.1 - - [04/Jun/2025:08:40:14 +0000] "PUT /devstoreaccount1/cont/pxhhqwuvroyansvqnhqesfctmxumcqxv HTTP/1.1" 201 -
127.0.0.1 - - [04/Jun/2025:08:40:14 +0000] "PUT /devstoreaccount1/cont/xsryqxwufduvgksxxsshutbjssaselrl HTTP/1.1" 201 -
127.0.0.1 - - [04/Jun/2025:08:40:14 +0000] "PUT /devstoreaccount1/cont/tnjpvnnkdzvvetgxfgzkkvzmdbazxdzx HTTP/1.1" 201 -
127.0.0.1 - - [04/Jun/2025:08:40:14 +0000] "PUT /devstoreaccount1/cont/zgiatqurovqqlprcanqtrizoucspspqw HTTP/1.1" 201 -
127.0.0.1 - - [04/Jun/2025:08:40:14 +0000] "PUT /devstoreaccount1/cont/ybdkcgpobdbzjobyxilitalnontfqlat HTTP/1.1" 201 -
127.0.0.1 - - [04/Jun/2025:08:40:15 +0000] "PUT /devstoreaccount1/cont/cqrsztttsjclztrlllcznkllfzxpzvab HTTP/1.1" 201 -
127.0.0.1 - - [04/Jun/2025:08:40:15 +0000] "DELETE /devstoreaccount1/cont/pvhkarwmfpqinpylzmmpdkjwcugnlcfd HTTP/1.1" 202 -
127.0.0.1 - - [04/Jun/2025:08:40:15 +0000] "DELETE /devstoreaccount1/cont/djoumuwypyrihzljmfsbkrbjajlzzmeg HTTP/1.1" 202 -
127.0.0.1 - - [04/Jun/2025:08:40:15 +0000] "DELETE /devstoreaccount1/cont/ynawzbrzynobouimpptdbkcbxkdjzdvc HTTP/1.1" 202 -
127.0.0.1 - - [04/Jun/2025:08:40:15 +0000] "DELETE /devstoreaccount1/cont/stcpynygbtfvpajumlwqxwztjdoknsdy HTTP/1.1" 404 -
127.0.0.1 - - [04/Jun/2025:08:40:15 +0000] "DELETE /devstoreaccount1/cont/hrnpvobzrumqfhzkicxlmudjefdadkki HTTP/1.1" 404 -
127.0.0.1 - - [04/Jun/2025:08:40:15 +0000] "DELETE /devstoreaccount1/cont/jbgtxzkijqbxspfyhutmjkyfjdyyqzvn HTTP/1.1" 404 -
127.0.0.1 - - [04/Jun/2025:08:40:15 +0000] "DELETE /devstoreaccount1/cont/hcctaeorduriqqtapknopcpyrdeddfdu HTTP/1.1" 202 -
127.0.0.1 - - [04/Jun/2025:08:40:15 +0000] "DELETE /devstoreaccount1/cont/ckdayicxarsfsiuurpwlhgbpjlusyqrb HTTP/1.1" 202 -
127.0.0.1 - - [04/Jun/2025:08:40:15 +0000] "DELETE /devstoreaccount1/cont/cqrsztttsjclztrlllcznkllfzxpzvab HTTP/1.1" 202 -
127.0.0.1 - - [04/Jun/2025:08:40:15 +0000] "DELETE /devstoreaccount1/cont/tnjpvnnkdzvvetgxfgzkkvzmdbazxdzx HTTP/1.1" 202 -
127.0.0.1 - - [04/Jun/2025:08:40:15 +0000] "DELETE /devstoreaccount1/cont/pxhhqwuvroyansvqnhqesfctmxumcqxv HTTP/1.1" 202 -
127.0.0.1 - - [04/Jun/2025:08:40:15 +0000] "DELETE /devstoreaccount1/cont/gszfqjfwmatbjwjflkigdvipohzylync HTTP/1.1" 202 -
127.0.0.1 - - [04/Jun/2025:08:40:15 +0000] "DELETE /devstoreaccount1/cont/yljfckmlncaxjzdoeisjxyqhzicndnuu HTTP/1.1" 202 -
127.0.0.1 - - [04/Jun/2025:08:40:15 +0000] "DELETE /devstoreaccount1/cont/ygwucztvznsrabiojtkaewgubfkvgoyl HTTP/1.1" 202 -
127.0.0.1 - - [04/Jun/2025:08:40:15 +0000] "DELETE /devstoreaccount1/cont/xsryqxwufduvgksxxsshutbjssaselrl HTTP/1.1" 202 -
127.0.0.1 - - [04/Jun/2025:08:40:15 +0000] "DELETE /devstoreaccount1/cont/ybdkcgpobdbzjobyxilitalnontfqlat HTTP/1.1" 202 -
127.0.0.1 - - [04/Jun/2025:08:40:15 +0000] "DELETE /devstoreaccount1/cont/zgiatqurovqqlprcanqtrizoucspspqw HTTP/1.1" 202 -
127.0.0.1 - - [04/Jun/2025:08:40:15 +0000] "DELETE /devstoreaccount1/cont/qssgstdvgdamukagtimwgnatjbkacpbx HTTP/1.1" 202 -
2025-06-04 01:40:15 02226_filesystem_cache_profile_events: [ OK ] 37.13 sec.
2025-06-04 01:40:18 02184_ipv6_parsing: [ OK ] 2.96 sec.
2025-06-04 01:40:21 02166_arrow_dictionary_inference: [ OK ] 3.06 sec.
2025-06-04 01:40:25 02155_multiple_inserts_for_formats_with_suffix: [ OK ] 3.82 sec.
2025-06-04 01:40:27 02148_sql_user_defined_function_subquery: [ OK ] 1.67 sec.
2025-06-04 01:40:32 02105_table_function_file_partiotion_by: [ OK ] 4.64 sec.
2025-06-04 01:40:35 02028_add_default_database_for_alterquery_on_cluster: [ OK ] 2.73 sec.
2025-06-04 01:40:36 02025_dictionary_view_different_db: [ OK ] 1.71 sec.
2025-06-04 01:40:38 02015_column_default_dict_get_identifier: [ OK ] 1.57 sec.
2025-06-04 01:40:44 02015_global_in_threads: [ OK ] 6.19 sec.
2025-06-04 01:40:48 01913_exact_rows_before_limit_full: [ OK ] 3.37 sec.
2025-06-04 01:40:51 01903_ssd_cache_dictionary_array_type: [ OK ] 3.00 sec.
2025-06-04 01:40:54 01901_test_attach_partition_from: [ OK ] 2.67 sec.
2025-06-04 01:40:56 01850_dist_INSERT_preserve_error: [ OK ] 2.26 sec.
2025-06-04 01:40:58 01837_database_memory_ddl_dictionaries: [ OK ] 1.37 sec.
2025-06-04 01:41:00 01821_table_comment: [ OK ] 2.02 sec.
2025-06-04 01:41:04 01778_hierarchical_dictionaries: [ OK ] 4.03 sec.
2025-06-04 01:41:10 01754_direct_dictionary_complex_key: [ OK ] 5.48 sec.
2025-06-04 01:41:22 01737_clickhouse_server_wait_server_pool_long: [ OK ] 12.75 sec.
2025-06-04 01:41:24 01721_engine_file_truncate_on_insert: [ OK ] 1.53 sec.
2025-06-04 01:41:24 01710_projection_vertical_merges: [ SKIPPED ] 0.00 sec.
2025-06-04 01:41:24 Reason: not running for current build
2025-06-04 01:41:29 01681_cache_dictionary_simple_key: [ OK ] 4.83 sec.
2025-06-04 01:41:31 01646_system_restart_replicas_smoke: [ OK ] 1.68 sec.
2025-06-04 01:41:34 01603_rename_overwrite_bug: [ OK ] 2.73 sec.
2025-06-04 01:42:55 01593_concurrent_alter_mutations_kill_many_replicas_long: [ OK ] 80.71 sec.
2025-06-04 01:42:56 01575_disable_detach_table_of_dictionary: [ OK ] 1.82 sec.
2025-06-04 01:42:59 01527_clickhouse_local_optimize: [ OK ] 2.57 sec.
2025-06-04 01:43:07 01524_do_not_merge_across_partitions_select_final: [ OK ] 8.04 sec.
2025-06-04 01:43:12 01474_executable_dictionary: [ OK ] 4.48 sec.
2025-06-04 01:43:15 01471_calculate_ttl_during_merge: [ OK ] 2.68 sec.
2025-06-04 01:43:56 01459_manual_write_to_replicas_quorum_detach_attach: [ OK ] 40.92 sec.
2025-06-04 01:45:43 01459_manual_write_to_replicas: [ OK ] 106.75 sec.
2025-06-04 01:46:37 01414_mutations_and_errors_zookeeper: [ OK ] 53.58 sec.
2025-06-04 01:46:50 01410_nullable_key_more_tests: [ OK ] 13.81 sec.
2025-06-04 01:47:07 01375_storage_file_tsv_csv_with_names_write_prefix: [ OK ] 16.76 sec.
2025-06-04 01:47:15 01360_materialized_view_with_join_on_query_log: [ OK ] 7.34 sec.
2025-06-04 01:47:18 01356_view_threads: [ OK ] 3.43 sec.
2025-06-04 01:47:31 01305_replica_create_drop_zookeeper: [ OK ] 12.96 sec.
2025-06-04 01:48:05 01301_aggregate_state_exception_memory_leak: [ OK ] 33.46 sec.
2025-06-04 01:48:12 01297_create_quota: [ OK ] 7.23 sec.
2025-06-04 01:48:16 01295_create_row_policy: [ OK ] 3.17 sec.
2025-06-04 01:48:17 01294_system_distributed_on_cluster: [ OK ] 1.46 sec.
2025-06-04 01:48:20 01281_unsucceeded_insert_select_queries_counter: [ OK ] 2.97 sec.
2025-06-04 01:50:00 01275_parallel_mv: [ OK ] 100.06 sec.
2025-06-04 01:50:02 01225_show_create_table_from_dictionary: [ OK ] 1.46 sec.
2025-06-04 01:50:54 01192_rename_database_zookeeper: [ OK ] 52.33 sec.
2025-06-04 01:50:57 01164_alter_memory_database: [ OK ] 1.91 sec.
2025-06-04 01:50:58 01110_dictionary_layout_without_arguments: [ OK ] 1.47 sec.
2025-06-04 01:51:02 01103_distributed_product_mode_local_column_renames: [ OK ] 4.14 sec.
2025-06-04 01:51:11 01091_num_threads: [ OK ] 8.48 sec.
2025-06-04 01:51:49 01083_expressions_in_engine_arguments: [ OK ] 37.48 sec.
2025-06-04 01:51:54 01070_materialize_ttl: [ OK ] 5.58 sec.
2025-06-04 01:51:59 01070_mutations_with_dependencies: [ OK ] 4.23 sec.
2025-06-04 01:52:05 01070_modify_ttl: [ OK ] 6.24 sec.
2025-06-04 01:52:15 01053_ssd_dictionary: [ OK ] 9.85 sec.
2025-06-04 01:52:26 01038_dictionary_lifetime_min_zero_sec: [ OK ] 10.90 sec.
2025-06-04 01:52:29 01036_no_superfluous_dict_reload_on_create_database_2: [ OK ] 2.33 sec.
2025-06-04 01:52:31 01023_materialized_view_query_context: [ OK ] 2.18 sec.
2025-06-04 01:52:47 01018_ddl_dictionaries_concurrent_requrests: [ OK ] 15.60 sec.
2025-06-04 01:52:57 01018_ddl_dictionaries_bad_queries: [ OK ] 9.90 sec.
2025-06-04 01:53:23 01014_lazy_database_concurrent_recreate_reattach_and_show_tables: [ OK ] 26.61 sec.
2025-06-04 01:53:29 01013_sync_replica_timeout_zookeeper: [ OK ] 5.83 sec.
2025-06-04 01:53:45 01004_rename_deadlock: [ OK ] 16.03 sec.
2025-06-04 01:53:48 00971_query_id_in_logs: [ OK ] 2.17 sec.
2025-06-04 01:53:49 00963_achimbab: [ OK ] 1.22 sec.
2025-06-04 01:53:57 00950_dict_get: [ OK ] 7.94 sec.
2025-06-04 01:53:57 00877_memory_limit_for_new_delete: [ SKIPPED ] 0.00 sec.
2025-06-04 01:53:57 Reason: not running for current build
2025-06-04 01:54:30 00840_long_concurrent_select_and_drop_deadlock: [ OK ] 32.76 sec.
2025-06-04 01:54:33 00722_inner_join: [ OK ] 3.33 sec.
2025-06-04 01:54:36 00693_max_block_size_system_tables_columns: [ OK ] 2.98 sec.
2025-06-04 01:54:42 00510_materizlized_view_and_deduplication_zookeeper: [ OK ] 5.88 sec.
2025-06-04 01:54:42 00002_log_and_exception_messages_formatting: [ SKIPPED ] 0.00 sec.
2025-06-04 01:54:42 Reason: skip
2025-06-04 01:54:42
2025-06-04 01:54:42 120 tests passed. 6 tests skipped. 2106.75 s elapsed (MainProcess).
2025-06-04 01:54:46 Won't run stateful tests because test data wasn't loaded.
2025-06-04 01:54:46 Checking the hung queries: done
2025-06-04 01:54:46
2025-06-04 01:54:46 No queries hung.
2025-06-04 01:54:46 All tests have finished.
2025-06-04 01:54:46
2025-06-04 01:54:46 Top patterns of log messages:
2025-06-04 01:54:46
2025-06-04 01:54:46 count count_% size size_% uniq_loggers uniq_threads levels background_% message_format_string
2025-06-04 01:54:46
2025-06-04 01:54:46 1. 58560 0.057 11.30 MiB 0.099 1 105 ['Debug'] 0 (from {}{}{}){}{} {} (stage: {})
2025-06-04 01:54:46 2. 58542 0.057 8.77 MiB 0.077 19128 103 ['Trace'] 1 {} Creating query context from {} context, user_id: {}, parent context user: {}
2025-06-04 01:54:46 3. 50896 0.05 1.23 MiB 0.011 1 372 ['Trace'] 0.001 Query to stage {}{}
2025-06-04 01:54:46 4. 50419 0.049 2.39 MiB 0.021 1 372 ['Trace'] 0.001 Query from stage {} to stage {}{}
2025-06-04 01:54:46 5. 46589 0.045 1.28 MiB 0.011 1 102 ['Debug'] 0 Processed in {} sec.
2025-06-04 01:54:46 6. 32621 0.032 2.54 MiB 0.022 1 99 ['Debug'] 0 Read {} rows, {} in {} sec., {} rows/sec., {}/sec.
2025-06-04 01:54:46 7. 29180 0.028 1.27 MiB 0.011 1 1 ['Trace'] 1 Processing requests batch, size: {}, bytes: {}
2025-06-04 01:54:46 8. 24766 0.024 1.70 MiB 0.015 1 1646 ['Trace'] 0.497 Reserved {} on local disk {}, having unreserved {}.
2025-06-04 01:54:46 9. 22637 0.022 1.53 MiB 0.013 1288 1647 ['Trace'] 0.478 Trying to reserve {} using storage policy from min volume index {}
2025-06-04 01:54:46 10. 21935 0.021 1.01 MiB 0.009 1 1140 ['Trace'] 0.275 filled checksums {}
2025-06-04 01:54:46 11. 21375 0.021 2.45 MiB 0.021 1294 728 ['Trace'] 0.352 Renaming temporary part {} to {} with tid {}.
2025-06-04 01:54:46 12. 19476 0.019 886.07 KiB 0.008 19476 184 ['Debug'] 0.996 Authenticating user '{}' from {}
2025-06-04 01:54:46 13. 19472 0.019 2.14 MiB 0.019 19472 184 ['Debug'] 0.996 {} Authenticated with global context as user {}
2025-06-04 01:54:46 14. 19446 0.019 1.67 MiB 0.015 19446 184 ['Debug'] 0.996 {} Logout, user_id: {}
2025-06-04 01:54:46 15. 19295 0.019 1.38 MiB 0.012 19295 103 ['Debug'] 1 Creating session context with user_id: {}
2025-06-04 01:54:46 16. 15613 0.015 783.29 KiB 0.007 1 119 ['Debug'] 0.271 Peak memory usage{}: {}.
2025-06-04 01:54:46 17. 14790 0.014 1.30 MiB 0.011 1 1848 ['Trace'] 0 Aggregated. {} to {} rows (from {}) in {} sec. ({:.3f} rows/sec., {}/sec.)
2025-06-04 01:54:46 18. 14557 0.014 437.36 KiB 0.004 1 1847 ['Trace'] 0 Aggregation method: {}
2025-06-04 01:54:46 19. 14066 0.014 1.73 MiB 0.015 1 2 ['Trace'] 1 Creating part at path {}
2025-06-04 01:54:46 20. 12453 0.012 2.58 MiB 0.023 3 103 ['Trace'] 1 HTTP Request for {}. Method: {}, Address: {}, User-Agent: {}{}, Content Type: {}, Transfer Encoding: {}, X-Forwarded-For: {}
2025-06-04 01:54:46 21. 12449 0.012 7.60 MiB 0.067 2 103 ['Trace'] 1 Request URI: {}
2025-06-04 01:54:46 22. 12045 0.012 247.02 KiB 0.002 2 103 ['Debug'] 0.123 Done processing query
2025-06-04 01:54:46 23. 12035 0.012 1.11 MiB 0.01 1 47 ['Debug'] 0 Reading {} marks from part {}, total {} rows starting from the beginning of the part
2025-06-04 01:54:46 24. 10500 0.01 112.79 KiB 0.001 1 1737 ['Trace'] 0.001 Aggregating
2025-06-04 01:54:46 25. 8835 0.009 198.44 KiB 0.002 1 1405 ['Trace'] 0.001 Merging aggregated data
2025-06-04 01:54:46 26. 8791 0.009 287.15 KiB 0.002 2 102 ['Trace'] 1 TCP Request. Address: {}
2025-06-04 01:54:46 27. 8791 0.009 850.61 KiB 0.007 1 102 ['Debug'] 1 Connected {} version {}.{}.{}, revision: {}{}{}.
2025-06-04 01:54:46 28. 8751 0.009 230.74 KiB 0.002 1 102 ['Debug'] 1 Done processing connection.
2025-06-04 01:54:46 29. 8284 0.008 654.42 KiB 0.006 752 101 ['Trace'] 0.001 Reading {} ranges in{}order from part {}, approx. {} rows starting from {}
2025-06-04 01:54:46 30. 8268 0.008 673.43 KiB 0.006 1 1734 ['Trace'] 0 An entry for key={} found in cache: sum_of_sizes={}, median_size={}
2025-06-04 01:54:46 31. 8170 0.008 287.24 KiB 0.002 1 43 ['Trace'] 1 Keeper request. Address: {}
2025-06-04 01:54:46 32. 7164 0.007 265.07 KiB 0.002 839 123 ['Debug'] 0.007 Key condition: {}
2025-06-04 01:54:46 33. 6804 0.007 299.00 KiB 0.003 838 123 ['Trace'] 0.007 Filtering marks by primary and secondary keys
2025-06-04 01:54:46 34. 6717 0.007 766.19 KiB 0.007 832 123 ['Debug'] 0.007 Selected {}/{} parts by partition key, {} parts by primary key, {}/{} marks by primary key, {} marks to read from {} ranges
2025-06-04 01:54:46 35. 6639 0.006 207.47 KiB 0.002 1 14 ['Debug'] 1 Receive four letter command {}
2025-06-04 01:54:46 36. 6502 0.006 273.03 KiB 0.002 1746 100 ['Debug'] 0.019 Found {} non used tables in detached tables.
2025-06-04 01:54:46 37. 6502 0.006 387.33 KiB 0.003 1746 100 ['Debug'] 0.019 There are {} detached tables. Start searching non used tables.
2025-06-04 01:54:46 38. 5973 0.006 347.00 KiB 0.003 18 18 ['Trace'] 1 Flushing system log, {} entries to flush up to offset {}
2025-06-04 01:54:46 39. 5973 0.006 216.43 KiB 0.002 18 18 ['Trace'] 1 Flushed system log up to offset {}
2025-06-04 01:54:46 40. 5947 0.006 509.54 KiB 0.004 254 512 ['Trace'] 1 Scheduling next merge selecting task after {}ms, current attempt status: {}
2025-06-04 01:54:46 41. 5947 0.006 307.80 KiB 0.003 748 123 ['Trace'] 0.008 Spreading mark ranges among streams (default reading)
2025-06-04 01:54:46 42. 5906 0.006 455.64 KiB 0.004 1 91 ['Trace'] 0 Query span trace_id for opentelemetry log: {}
2025-06-04 01:54:46 43. 5786 0.006 805.47 KiB 0.007 152 512 ['Trace'] 1 Checked {} partitions, found {} partitions with parts that may be merged: [{}] (max_total_size_to_merge={}, merge_with_ttl_allowed={})
2025-06-04 01:54:46 44. 5676 0.006 458.82 KiB 0.004 169 1147 ['Trace'] 0.774 Part {} is not stored on zero-copy replicated disk, blobs can be removed
2025-06-04 01:54:46 45. 4713 0.005 840.80 KiB 0.007 1 76 ['Trace'] 0.008 PREWHERE condition was split into {} steps: {}
2025-06-04 01:54:46 46. 4576 0.004 416.17 KiB 0.004 158 514 ['Trace'] 0.999 Insert entry {} to queue with type {}
2025-06-04 01:54:46 47. 4472 0.004 474.25 KiB 0.004 1 31 ['Debug'] 0 Reading {} marks from part {}, total {} rows starting from the beginning of the part, column {}
2025-06-04 01:54:46 48. 4449 0.004 256.34 KiB 0.002 158 514 ['Debug'] 0.999 Pulling {} entries to queue: {} - {}
2025-06-04 01:54:46 49. 4449 0.004 112.96 KiB 0.001 158 514 ['Debug'] 0.999 Pulled {} entries to queue.
2025-06-04 01:54:46 50. 3942 0.004 210.20 KiB 0.002 272 550 ['Debug'] 0.914 Selected {} parts from {} to {}
2025-06-04 01:54:46 51. 3730 0.004 1.25 MiB 0.011 2 13 ['Error'] 0 Number of arguments for function {} doesn't match: passed {}, should be {}
2025-06-04 01:54:46 52. 3719 0.004 296.08 KiB 0.003 1 1232 ['Trace'] 0 Statistics updated for key={}: new sum_of_sizes={}, median_size={}
2025-06-04 01:54:46 53. 3651 0.004 726.65 KiB 0.006 1 1232 ['Information'] 1 Removing metadata {} of dropped table {}
2025-06-04 01:54:46 54. 3650 0.004 420.61 KiB 0.004 1 75 ['Debug'] 0 Done waiting for the table {} to be dropped. The outcome: {}
2025-06-04 01:54:46 55. 3650 0.004 270.90 KiB 0.002 1 75 ['Debug'] 0 Waiting for table {} to be finally dropped
2025-06-04 01:54:46 56. 3596 0.004 296.70 KiB 0.003 1 51 ['Debug'] 0 Merging {} parts: from {} to {} into {} with storage {}
2025-06-04 01:54:46 57. 3596 0.004 122.84 KiB 0.001 1 51 ['Debug'] 0 Selected MergeAlgorithm: {}
2025-06-04 01:54:46 58. 3590 0.004 467.25 KiB 0.004 1 51 ['Debug'] 0 Merge sorted {} rows, containing {} columns ({} merged, {} gathered) in {} sec., {} rows/sec., {}/sec.
2025-06-04 01:54:46 59. 3580 0.003 233.17 KiB 0.002 288 51 ['Trace'] 0 Merged {} parts: [{}, {}] -> {}
2025-06-04 01:54:46 60. 3534 0.003 255.39 KiB 0.002 1 512 ['Information'] 1 Have {} tables in drop queue ({} of them are in use), will try drop {} tables
2025-06-04 01:54:46 61. 3523 0.003 244.42 KiB 0.002 1 645 ['Debug'] 1 Finish load job '{}' with status {}
2025-06-04 01:54:46 62. 3523 0.003 268.50 KiB 0.002 1 74 ['Debug'] 0.001 Schedule load job '{}' into {}
2025-06-04 01:54:46 63. 3523 0.003 99.78 KiB 0.001 1 942 ['Debug'] 1 Stop worker in {}
2025-06-04 01:54:46 64. 3523 0.003 137.62 KiB 0.001 1 716 ['Debug'] 0.501 Spawn loader worker #{} in {}
2025-06-04 01:54:46 65. 3523 0.003 258.18 KiB 0.002 1 645 ['Debug'] 1 Execute load job '{}' in {}
2025-06-04 01:54:46 66. 3522 0.003 326.91 KiB 0.003 1 74 ['Debug'] 0.001 Prioritize load job '{}': {} -> {}
2025-06-04 01:54:46 67. 3522 0.003 30.96 KiB 0 2 74 ['Trace'] 0.001 No tables
2025-06-04 01:54:46 68. 3517 0.003 104.80 KiB 0.001 153 348 ['Trace'] 0.014 Found (RIGHT) boundary mark: {}
2025-06-04 01:54:46 69. 3517 0.003 109.18 KiB 0.001 153 348 ['Trace'] 0.014 Found {} range {}in {} steps
2025-06-04 01:54:46 70. 3517 0.003 101.30 KiB 0.001 153 348 ['Trace'] 0.014 Found (LEFT) boundary mark: {}
2025-06-04 01:54:46 71. 3517 0.003 247.24 KiB 0.002 153 348 ['Trace'] 0.014 Running binary search on index range for part {} ({} marks)
2025-06-04 01:54:46 72. 3500 0.003 116.21 KiB 0.001 1 714 ['Debug'] 0.501 Change current priority: {} -> {}
2025-06-04 01:54:46 73. 3177 0.003 363.31 KiB 0.003 1089 644 ['Debug'] 0.975 Removing {} parts from filesystem (serially): Parts: [{}]
2025-06-04 01:54:46 74. 3168 0.003 582.81 KiB 0.005 1 67 ['Trace'] 0.001 {}Keys: {}, datatype: {}, kind: {}, strictness: {}, right header: {}
2025-06-04 01:54:46 75. 3068 0.003 125.33 KiB 0.001 131 37 ['Debug'] 0.485 Committing part {} to zookeeper
2025-06-04 01:54:46 76. 2958 0.003 365.38 KiB 0.003 1 2 ['Trace'] 1 MemoryTracking: was {}, peak {}, free memory in arenas {}, will set to {} (RSS), difference: {}
2025-06-04 01:54:46 77. 2911 0.003 116.55 KiB 0.001 99 353 ['Debug'] 0.581 Will use old analyzer to prepare mutation
2025-06-04 01:54:46 78. 2800 0.003 89.93 KiB 0.001 20 44 ['Debug'] 0 Requested flush up to offset {}
2025-06-04 01:54:46 79. 2779 0.003 110.23 KiB 0.001 128 32 ['Debug'] 0.533 Part {} committed to zookeeper
2025-06-04 01:54:46 80. 2320 0.002 67.97 KiB 0.001 249 509 ['Debug'] 0.994 Updating strategy picker state
2025-06-04 01:54:46 81. 2251 0.002 270.29 KiB 0.002 1 36 ['Trace'] 0 Have {} pending inserts with total {} bytes of data for query '{}'
2025-06-04 01:54:46 82. 2173 0.002 209.76 KiB 0.002 118 114 ['Trace'] 0.959 Found {} old parts to remove. Parts: [{}]
2025-06-04 01:54:46 83. 2173 0.002 211.89 KiB 0.002 118 114 ['Debug'] 0.959 Removing {} parts from memory: Parts: [{}]
2025-06-04 01:54:46 84. 2061 0.002 150.26 KiB 0.001 1 78 ['Trace'] 0.01 The min valid primary key position for moving to the tail of PREWHERE is {}
2025-06-04 01:54:46 85. 2014 0.002 7.90 MiB 0.069 3 11 ['Error'] 0 Value passed to '{}' function is non-zero
2025-06-04 01:54:46 86. 1916 0.002 130.25 KiB 0.001 1 75 ['Trace'] 0.011 Condition {} moved to PREWHERE
2025-06-04 01:54:46 87. 1905 0.002 213.48 KiB 0.002 90 33 ['Debug'] 0.999 Fetching part {} from {}:{}
2025-06-04 01:54:46 88. 1857 0.002 159.59 KiB 0.001 90 33 ['Trace'] 1 Trying to fetch with zero-copy replication, but disk is not provided, will try to select
2025-06-04 01:54:46 89. 1857 0.002 67.08 KiB 0.001 90 33 ['Trace'] 1 Checking disk {} with type {}
2025-06-04 01:54:46 90. 1761 0.002 104.07 KiB 0.001 1 74 ['Information'] 0.001 Parsed metadata of {} tables in {} databases in {} sec
2025-06-04 01:54:46 91. 1761 0.002 144.55 KiB 0.001 1753 74 ['Information'] 0.001 Metadata processed, database {} has {} tables and {} dictionaries in total.
2025-06-04 01:54:46 92. 1707 0.002 90.77 KiB 0.001 8 75 ['Trace'] 0.961 List of all grants: {}
2025-06-04 01:54:46 93. 1707 0.002 130.03 KiB 0.001 8 75 ['Trace'] 0.961 Settings: readonly = {}, allow_ddl = {}, allow_introspection_functions = {}
2025-06-04 01:54:46 94. 1707 0.002 141.24 KiB 0.001 8 75 ['Trace'] 0.961 List of all grants including implicit: {}
2025-06-04 01:54:46 95. 1668 0.002 29.32 KiB 0 1537 91 ['Debug'] 0.014 Loading data parts
2025-06-04 01:54:46 96. 1639 0.002 113.76 KiB 0.001 1 74 ['Debug'] 0.001 Wait load job '{}' in {}
2025-06-04 01:54:46 97. 1587 0.002 146.04 KiB 0.001 6 12 ['Debug'] 0 Waiting for currently running merges ({} parts are merging right now) to perform OPTIMIZE FINAL
2025-06-04 01:54:46 98. 1565 0.002 35.15 KiB 0 1537 91 ['Debug'] 0.015 There are no data parts
2025-06-04 01:54:46 99. 1512 0.001 26.58 KiB 0 1512 676 ['Trace'] 0.998 dropAllData: done.
2025-06-04 01:54:46 100. 1512 0.001 45.77 KiB 0 1512 676 ['Trace'] 0.998 dropAllData: waiting for locks.
2025-06-04 01:54:46
2025-06-04 01:54:47 count count_% size size_% uniq_loggers uniq_threads levels background_% message_format_string
2025-06-04 01:54:47
2025-06-04 01:54:47
2025-06-04 01:54:47
2025-06-04 01:54:47 Top messages without format string (fmt::runtime):
2025-06-04 01:54:47
2025-06-04 01:54:47 count pattern runtime_message line
2025-06-04 01:54:47
2025-06-04 01:54:47 1. 12 CodeDBExceptionSyntaxerrorfailed Code: 62. DB::Exception: Syntax error: failed at position 1 ('SEECTwrong'): SEECTwrong. Expected one of: Query, Query with output, EXPLAIN, EXPLAIN, SELECT query, possibly with UNION, list of union elements, SELECT query, subquery, possibly with UNION, SEL ('/executeQuery.cpp',221)
2025-06-04 01:54:47 2. 4 CodeDBExceptionExpectedargumento Code: 395. DB::Exception: Expected argument of data type real: while executing 'FUNCTION throwIf(_CAST(true_Bool, 'Bool'_String) :: 1, 'Expected argument of data type real'_String :: 2) -> throwIf(_CAST(true_Bool, 'Bool'_String), 'Expected argument of data ('/executeQuery.cpp',221)
2025-06-04 01:54:47 3. 4 CodeDBExceptionEmptyqueryInscope Code: 62. DB::Exception: Empty query: In scope SELECT formatQuery(''). (SYNTAX_ERROR) (version 24.8.14.10028.altinitytest (altinity build)) (from [::1]:43472) (comment: 02882_formatQuery.sql) (in query: SELECT formatQuery('');), Stack trace (when copying t ('/executeQuery.cpp',221)
2025-06-04 01:54:47 4. 4 CodeDBExceptionEmptyquerywhileex Code: 62. DB::Exception: Empty query: while executing 'FUNCTION formatQuery(__table1.query : 2) -> formatQuery(__table1.query) String : 1'. (SYNTAX_ERROR) (version 24.8.14.10028.altinitytest (altinity build)) (from [::1]:43472) (comment: 02882_formatQuery. ('/executeQuery.cpp',221)
2025-06-04 01:54:47 5. 4 CodeDBExceptionTherequestsignatu Code: 499. DB::Exception: The request signature we calculated does not match the signature you provided. Check your key and signing method. (S3_ERROR) (version 24.8.14.10028.altinitytest (altinity build)) (from [::1]:34904) (comment: 02843_backup_use_same_ ('/executeQuery.cpp',221)
2025-06-04 01:54:47 6. 3 IfthesignaturecheckfailedThiscou If the signature check failed. This could be because of a time skew. Attempting to adjust the signer. ('/AWSLogger.cpp',71)
2025-06-04 01:54:47 7. 2 CodeDBExceptionReceivedfromDBExc Code: 36. DB::Exception: Received from 127.0.0.1:9000. DB::Exception: Chosen number of marks to read is zero (likely because of weird interference of settings). Stack trace:
2025-06-04 01:54:47
2025-06-04 01:54:47 0. ./contrib/llvm-project/libcxx/include/exception:141: Poco::Exception::Exceptio ('/executeQuery.cpp',221)
2025-06-04 01:54:47 8. 2 CodeDBExceptionReceivedfromlocal Code: 60. DB::Exception: Received from localhost:9000. DB::Exception: Table shard_1.data_01850 does not exist. Maybe you meant shard_0.data_01850?. Stack trace:
2025-06-04 01:54:47
2025-06-04 01:54:47 0. ./contrib/llvm-project/libcxx/include/exception:141: Poco::Exception::Exception(String cons ('/executeQuery.cpp',221)
2025-06-04 01:54:47 9. 1 Electiontimeoutinitiateleaderele Election timeout, initiate leader election ('/LoggerWrapper.h',43)
2025-06-04 01:54:47 10. 1 bgappendentriesthreadinitiated bg append_entries thread initiated ('/LoggerWrapper.h',43)
2025-06-04 01:54:47 11. 1 CodeDBExceptionavroExceptionCann Code: 1001. DB::Exception: avro::Exception: Cannot read compressed data, expected at least 4 bytes, got 0. (STD_EXCEPTION), Stack trace (when copying this message, always include the lines below):
2025-06-04 01:54:47
2025-06-04 01:54:47 0. ./contrib/llvm-project/libcxx/include/exception:141: st ('/TCPHandler.cpp',765)
2025-06-04 01:54:47 12. 1 StartingClickHousealtinitytestre Starting ClickHouse 24.8.14.10028.altinitytest (revision: 4294967295, git hash: 26cde36666d2d6cc9dfb4a4bae80ad1b5f89df57, build id: C82F0B3E2B912D10D0DC1CE4014FA3827B20FDF9), PID 592 ('',0)
2025-06-04 01:54:47 13. 1 newconfigurationlogidxprevlogidx new configuration: log idx 1, prev log idx 0
2025-06-04 01:54:47 peer 1, DC ID 0, localhost:9234, voting member, 1
2025-06-04 01:54:47 my id: 1, leader: 1, term: 1 ('/LoggerWrapper.h',43)
2025-06-04 01:54:47 14. 1 stdexceptionCodetypestdruntimeer std::exception. Code: 1001, type: std::runtime_error, e.what() = ran out of bytes (version 24.8.14.10028.altinitytest (altinity build)) (from [::1]:38802) (comment: 02688_aggregate_states.sql) (in query: SELECT '\x01\x01\x01'::AggregateFunction(groupBitmap ('/executeQuery.cpp',221)
2025-06-04 01:54:47 15. 1 waitforHBforms wait for HB, for 50 + [0, 0] ms ('/LoggerWrapper.h',43)
2025-06-04 01:54:47 16. 1 statemachinecommitindexprecommit state machine commit index 0, precommit index 0, last log index 0 ('/LoggerWrapper.h',43)
2025-06-04 01:54:47 17. 1 CodeDBExceptionstdruntimeerrorra Code: 1001. DB::Exception: std::runtime_error: ran out of bytes. (STD_EXCEPTION), Stack trace (when copying this message, always include the lines below):
2025-06-04 01:54:47
2025-06-04 01:54:47 0. ./contrib/llvm-project/libcxx/include/exception:141: std::runtime_error::runtime_error(char const ('/TCPHandler.cpp',765)
2025-06-04 01:54:47 18. 1 FailedtomakebackupShttplocalhost Failed to make backup S3('http://localhost:11111/test/backups/test_9l25u0qn/use_same_s3_credentials_for_base_backup_base_inc_3_bad', 'test', '[HIDDEN]'): Code: 499. DB::Exception: The request signature we calculated does not match the signature you provide ('/Exception.cpp',273)
2025-06-04 01:54:47 19. 1 Errorwhenexecutingfourlettercomm Error when executing four letter command cons: Poco::Exception. Code: 1000, e.code() = 107, Net Exception: Socket is not connected, Stack trace (when copying this message, always include the lines below):
2025-06-04 01:54:47
2025-06-04 01:54:47 0. ./contrib/llvm-project/libcxx/include/exception ('/Exception.cpp',273)
2025-06-04 01:54:47 20. 1 Forkedachildprocesstowatch Forked a child process to watch ('',0)
2025-06-04 01:54:47 21. 1 stdexceptionCodetypeavroExceptio std::exception. Code: 1001, type: avro::Exception, e.what() = Cannot read compressed data, expected at least 4 bytes, got 0 (version 24.8.14.10028.altinitytest (altinity build)) (from [::1]:48146) (comment: 02373_heap_buffer_overflow_in_avro.sh) (in query: ('/executeQuery.cpp',221)
2025-06-04 01:54:47 22. 1 invalidelectiontimeoutupperbound invalid election timeout upper bound detected, adjusted to 0 ('/LoggerWrapper.h',43)
2025-06-04 01:54:47 23. 1 INITRAFTSERVERcommitindextermele === INIT RAFT SERVER ===
2025-06-04 01:54:47 commit index 0
2025-06-04 01:54:47 term 0
2025-06-04 01:54:47 election timer allowed
2025-06-04 01:54:47 log store start 1, end 0
2025-06-04 01:54:47 config log idx 0, prev log idx 0
2025-06-04 01:54:47 -- ASYNC REPLICATION -- ('/LoggerWrapper.h',43)
2025-06-04 01:54:47 24. 1 ELECTIONTIMEOUTcurrentrolefollow [ELECTION TIMEOUT] current role: follower, log last term 0, state term 0, target p 1, my p 1, hb dead, pre-vote NOT done ('/LoggerWrapper.h',43)
2025-06-04 01:54:47 25. 1 globalmanagerdoesnotexistwilluse global manager does not exist. will use local thread for commit and append ('/LoggerWrapper.h',43)
2025-06-04 01:54:47 26. 1 BECOMELEADERappendednewconfigat [BECOME LEADER] appended new config at 1 ('/LoggerWrapper.h',43)
2025-06-04 01:54:47 27. 1 newconfiglogidxprevlogidxcurconf new config log idx 1, prev log idx 0, cur config log idx 0, prev log idx 0 ('/LoggerWrapper.h',43)
2025-06-04 01:54:47 28. 1 newelectiontimeoutrange new election timeout range: 0 - 0 ('/LoggerWrapper.h',43)
2025-06-04 01:54:47 29. 1 startingup starting up ('',0)
2025-06-04 01:54:50 30. 1 PRIORITYdecaytargetmine [PRIORITY] decay, target 1 -> 1, mine 1 ('/LoggerWrapper.h',43)
2025-06-04 01:54:50
2025-06-04 01:54:50
2025-06-04 01:54:50
2025-06-04 01:54:50 Top messages not matching their format strings:
2025-06-04 01:54:50
2025-06-04 01:54:50 message_format_string count() any_message
2025-06-04 01:54:50
2025-06-04 01:54:50 1. 28 std::exception. Code: 1001, type: std::runtime_error, e.what() = ran out of bytes (version 24.8.14.10028.altinitytest (altinity build)) (from [::1]:38802) (comment: 02688_aggregate_states.sql) (in query: SELECT '\x01\x01\x01'::AggregateFunction(groupBitmap, UInt64);), Stack trace (when copying this message, always include the lines below):
2025-06-04 01:54:50
2025-06-04 01:54:50 0. ./contrib/llvm-project/libcxx/include/exception:141: std::runtime_error::runtime_error(char const*) @ 0x0000000047c5e5a3
2025-06-04 01:54:50 1. ./contrib/croaring/cpp/roaring64map.hh:0: roaring::Roaring64Map::readSafe(char const*, unsigned long) @ 0x000000002f17e95b
2025-06-04 01:54:50 2. ./src/AggregateFunctions/AggregateFunctionGroupBitmapData.h:0: _ZN2DB25RoaringBitmapWithSmallSetImLDu32EE4readERNS_10ReadBufferE @ 0x000000002f17d409
2025-06-04 01:54:50 3. ./build_docker/./src/AggregateFunctions/AggregateFunctionGroupBitmap.cpp:61: DB::(anonymous namespace)::AggregateFunctionBitmap>::deserialize(char*, DB::ReadBuffer&, std::optional, DB::Arena*) const @ 0x000000002f08d910
2025-06-04 01:54:50 4. ./src/Common/PODArray.h:427: DB::deserializeFromString(std::shared_ptr const&, DB::IColumn&, String const&, unsigned long) @ 0x0000000032651563
2025-06-04 01:54:50 5. ./contrib/llvm-project/libcxx/include/string:1499: DB::SerializationAggregateFunction::deserializeWholeText(DB::IColumn&, DB::ReadBuffer&, DB::FormatSettings const&) const @ 0x0000000032651d7c
2025-06-04 01:54:50 6. DB::(anonymous namespace)::ConvertImplGenericFromString::execute(std::vector>&, std::shared_ptr const&, DB::ColumnNullable const*, unsigned long, std::shared_ptr const&) @ 0x00000000086e80f0
2025-06-04 01:54:50 7. COW::immutable_ptr std::__function::__policy_invoker::immutable_ptr (std::vector>&, std::shared_ptr const&, DB::ColumnNullable const*, unsigned long)>::__call_impl const&, DB::DataTypeAggregateFunction const*) const::'lambda'(std::vector>&, std::shared_ptr const&, DB::ColumnNullable const*, unsigned long), COW::immutable_ptr (std::vector>&, std::shared_ptr const&, DB::ColumnNullable const*, unsigned long)>>(std::__function::__policy_storage const*, std::vector>&, std::shared_ptr const&, DB::ColumnNullable const*, unsigned long) @ 0x0000000009007380
2025-06-04 01:54:50 8. DB::(anonymous namespace)::ExecutableFunctionCast::executeImpl(std::vector> const&, std::shared_ptr const&, unsigned long) const @ 0x00000000086ceb34
2025-06-04 01:54:50 9. DB::IExecutableFunction::executeDryRunImpl(std::vector> const&, std::shared_ptr const&, unsigned long) const @ 0x0000000008421b22
2025-06-04 01:54:50 10. DB::IExecutableFunction::executeWithoutLowCardinalityColumns(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x000000000b5fe0d1
2025-06-04 01:54:50 11. DB::IExecutableFunction::defaultImplementationForConstantArguments(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x000000000b5fce10
2025-06-04 01:54:50 12. DB::IExecutableFunction::executeWithoutLowCardinalityColumns(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x000000000b5fdfaf
2025-06-04 01:54:50 13. DB::IExecutableFunction::executeWithoutSparseColumns(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x000000000b60027f
2025-06-04 01:54:50 14. DB::IExecutableFunction::execute(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x000000000b605e7e
2025-06-04 01:54:50 15. ./build_docker/./src/Analyzer/Resolve/QueryAnalyzer.cpp:0: DB::QueryAnalyzer::resolveFunction(std::shared_ptr&, DB::IdentifierResolveScope&) @ 0x00000000334a38b2
2025-06-04 01:54:50 16. ./contrib/llvm-project/libcxx/include/vector:553: DB::QueryAnalyzer::resolveExpressionNode(std::shared_ptr&, DB::IdentifierResolveScope&, bool, bool, bool) @ 0x0000000033442426
2025-06-04 01:54:50 17. ./build_docker/./src/Analyzer/Resolve/QueryAnalyzer.cpp:0: DB::QueryAnalyzer::resolveExpressionNodeList(std::shared_ptr&, DB::IdentifierResolveScope&, bool, bool) @ 0x000000003343f6b1
2025-06-04 01:54:50 18. ./build_docker/./src/Analyzer/Resolve/QueryAnalyzer.cpp:0: DB::QueryAnalyzer::resolveProjectionExpressionNodeList(std::shared_ptr&, DB::IdentifierResolveScope&) @ 0x00000000334d9400
2025-06-04 01:54:50 19. ./contrib/llvm-project/libcxx/include/vector:961: DB::QueryAnalyzer::resolveQuery(std::shared_ptr const&, DB::IdentifierResolveScope&) @ 0x000000003342a202
2025-06-04 01:54:50 20. ./build_docker/./src/Analyzer/Resolve/QueryAnalyzer.cpp:0: DB::QueryAnalyzer::resolve(std::shared_ptr&, std::shared_ptr const&, std::shared_ptr) @ 0x0000000033426c06
2025-06-04 01:54:50 21. ./build_docker/./src/Analyzer/Resolve/QueryAnalysisPass.cpp:0: DB::QueryAnalysisPass::run(std::shared_ptr&, std::shared_ptr) @ 0x00000000334250f9
2025-06-04 01:54:50 22. ./build_docker/./src/Analyzer/QueryTreePassManager.cpp:0: DB::QueryTreePassManager::run(std::shared_ptr) @ 0x0000000034971b19
2025-06-04 01:54:50 23. ./build_docker/./src/Interpreters/InterpreterSelectQueryAnalyzer.cpp:0: DB::(anonymous namespace)::buildQueryTreeAndRunPasses(std::shared_ptr const&, DB::SelectQueryOptions const&, std::shared_ptr const&, std::shared_ptr const&) @ 0x0000000034ce33e4
2025-06-04 01:54:50 24. ./build_docker/./src/Interpreters/InterpreterSelectQueryAnalyzer.cpp:0: DB::InterpreterSelectQueryAnalyzer::InterpreterSelectQueryAnalyzer(std::shared_ptr const&, std::shared_ptr const&, DB::SelectQueryOptions const&, std::vector> const&) @ 0x0000000034cdaa2e
2025-06-04 01:54:50 25. ./contrib/llvm-project/libcxx/include/__memory/unique_ptr.h:0: std::__unique_if::__unique_single std::make_unique[abi:v15007]&, std::shared_ptr const&, DB::SelectQueryOptions const&>(std::shared_ptr&, std::shared_ptr const&, DB::SelectQueryOptions const&) @ 0x0000000034ce5e55
2025-06-04 01:54:50 26. ./build_docker/./src/Interpreters/InterpreterSelectQueryAnalyzer.cpp:270: std::unique_ptr> std::__function::__policy_invoker> (DB::InterpreterFactory::Arguments const&)>::__call_impl> (DB::InterpreterFactory::Arguments const&)>>(std::__function::__policy_storage const*, DB::InterpreterFactory::Arguments const&) @ 0x0000000034ce59b3
2025-06-04 01:54:50 27. ./contrib/llvm-project/libcxx/include/__functional/function.h:818: ? @ 0x0000000034b810cc
2025-06-04 01:54:50 28. ./contrib/llvm-project/libcxx/include/__memory/unique_ptr.h:296: DB::executeQueryImpl(char const*, char const*, std::shared_ptr, DB::QueryFlags, DB::QueryProcessingStage::Enum, DB::ReadBuffer*) @ 0x00000000358a2337
2025-06-04 01:54:50 29. ./build_docker/./src/Interpreters/executeQuery.cpp:1397: DB::executeQuery(String const&, std::shared_ptr, DB::QueryFlags, DB::QueryProcessingStage::Enum) @ 0x0000000035896efd
2025-06-04 01:54:50 30. ./contrib/llvm-project/libcxx/include/__memory/shared_ptr.h:723: DB::TCPHandler::runImpl() @ 0x000000003abad9d8
2025-06-04 01:54:50 31. ./build_docker/./src/Server/TCPHandler.cpp:0: DB::TCPHandler::run() @ 0x000000003ac02bf1
2025-06-04 01:54:50
2025-06-04 01:54:50 message_format_string count() any_message
2025-06-04 01:54:50
2025-06-04 01:54:50 2. {} is in use (by merge/mutation/INSERT) (consider increasing temporary_directories_lifetime setting) 28 /var/lib/clickhouse/store/3b2/3b2b1920-1392-4a60-b7ed-631c438214b5/tmp_merge_202506_114_134_4/ is in use (by merge/mutation/INSERT) (consider increasing temporary_directories_lifetime setting) (skipped 1 similar messages)
2025-06-04 01:54:50 message_format_string count() any_message
2025-06-04 01:54:50
2025-06-04 01:54:50 3. Illegal UTF-8 sequence, while processing '{}' 12 Code: 36. DB::Exception: Illegal UTF-8 sequence, while processing '�': while executing 'FUNCTION stringJaccardIndexUTF8(materialize('hello'_String) :: 3, materialize('�'_String) :: 1) -> stringJaccardIndexUTF8(materialize('hello'_String), materialize('�'_String)) Float64 : 2'. (BAD_ARGUMENTS) (version 24.8.14.10028.altinitytest (altinity build)) (from [::1]:57272) (comment: 02884_string_distance_function.sql) (in query: SELECT stringJaccardIndexUTF8(materialize('hello'), materialize('\xC2\x01'));), Stack trace (when copying this message, always include the lines below):
2025-06-04 01:54:50
2025-06-04 01:54:50 0. ./contrib/llvm-project/libcxx/include/exception:141: Poco::Exception::Exception(String const&, int) @ 0x00000000403c32e9
2025-06-04 01:54:50 1. ./build_docker/./src/Common/Exception.cpp:111: DB::Exception::Exception(DB::Exception::MessageMasked&&, int, bool) @ 0x000000002002fdf3
2025-06-04 01:54:50 2. DB::Exception::Exception(PreformattedMessage&&, int) @ 0x000000000837bb9d
2025-06-04 01:54:50 3. DB::Exception::Exception(int, FormatStringHelperImpl::type>, StringRef&&) @ 0x000000000b452b8a
2025-06-04 01:54:50 4. DB::parseUTF8String(char const*, unsigned long, std::function, std::function) @ 0x000000000b45167a
2025-06-04 01:54:50 5. DB::ByteJaccardIndexImpl::process(char const*, unsigned long, char const*, unsigned long) @ 0x000000000b476772
2025-06-04 01:54:50 6. DB::FunctionsStringSimilarity>, DB::NameJaccardIndexUTF8>::executeImpl(std::vector> const&, std::shared_ptr const&, unsigned long) const @ 0x000000000b474953
2025-06-04 01:54:50 7. DB::FunctionToExecutableFunctionAdaptor::executeImpl(std::vector> const&, std::shared_ptr const&, unsigned long) const @ 0x00000000083d17db
2025-06-04 01:54:50 8. DB::IExecutableFunction::executeWithoutLowCardinalityColumns(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x000000000b5fe2ca
2025-06-04 01:54:50 9. DB::IExecutableFunction::executeWithoutSparseColumns(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x000000000b60009f
2025-06-04 01:54:50 10. DB::IExecutableFunction::execute(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x000000000b605e7e
2025-06-04 01:54:50 11. ./contrib/boost/boost/smart_ptr/intrusive_ptr.hpp:124: DB::ExpressionActions::execute(DB::Block&, unsigned long&, bool, bool) const @ 0x0000000033a15cbe
2025-06-04 01:54:50 12. ./build_docker/./src/Processors/Transforms/ExpressionTransform.cpp:0: DB::ExpressionTransform::transform(DB::Chunk&) @ 0x000000003b800c64
2025-06-04 01:54:50 13. ./contrib/llvm-project/libcxx/include/__utility/swap.h:35: DB::ISimpleTransform::transform(DB::Chunk&, DB::Chunk&) @ 0x0000000020acc644
2025-06-04 01:54:50 14. ./build_docker/./src/Processors/ISimpleTransform.cpp:99: DB::ISimpleTransform::work() @ 0x000000003ae3b86b
2025-06-04 01:54:50 15. ./contrib/llvm-project/libcxx/include/list:588: DB::ExecutionThreadContext::executeTask() @ 0x000000003aeabbcd
2025-06-04 01:54:50 16. ./build_docker/./src/Processors/Executors/PipelineExecutor.cpp:273: DB::PipelineExecutor::executeStepImpl(unsigned long, std::atomic*) @ 0x000000003ae7ab06
2025-06-04 01:54:50 17. ./build_docker/./src/Processors/Executors/PipelineExecutor.cpp:410: DB::PipelineExecutor::executeImpl(unsigned long, bool) @ 0x000000003ae78bc3
2025-06-04 01:54:50 18. ./contrib/llvm-project/libcxx/include/__memory/unique_ptr.h:274: DB::PipelineExecutor::execute(unsigned long, bool) @ 0x000000003ae78628
2025-06-04 01:54:50 19. ./build_docker/./src/Processors/Executors/PullingAsyncPipelineExecutor.cpp:0: void std::__function::__policy_invoker::__call_impl::ThreadFromGlobalPoolImpl(DB::PullingAsyncPipelineExecutor::pull(DB::Chunk&, unsigned long)::$_0&&)::'lambda'(), void ()>>(std::__function::__policy_storage const*) @ 0x000000003aeb8abd
2025-06-04 01:54:50 20. ./base/base/../base/wide_integer_impl.h:817: ThreadPoolImpl::ThreadFromThreadPool::worker() @ 0x00000000202cdfdd
2025-06-04 01:54:50 21. ./contrib/llvm-project/libcxx/include/__memory/unique_ptr.h:302: void* std::__thread_proxy[abi:v15007]>, void (ThreadPoolImpl::ThreadFromThreadPool::*)(), ThreadPoolImpl::ThreadFromThreadPool*>>(void*) @ 0x00000000202e0524
2025-06-04 01:54:50 22. ? @ 0x00007f28e8495ac3
2025-06-04 01:54:50 23. ? @ 0x00007f28e8527850
2025-06-04 01:54:50
2025-06-04 01:54:50 message_format_string count() any_message
2025-06-04 01:54:50
2025-06-04 01:54:50 4. Close WriteBufferFromAzureBlobStorage. {}. 2 Close WriteBufferFromAzureBlobStorage. qssgstdvgdamukagtimwgnatjbkacpbx. (LogSeriesLimiter: on interval from 2025-06-04 01:39:13 to 2025-06-04 01:40:04 accepted series 1 / 10 for the logger WriteBufferFromAzureBlobStorage)
2025-06-04 01:54:50 message_format_string count() any_message
2025-06-04 01:54:50
2025-06-04 01:54:50 5. (from {}{}{}){}{} {} (stage: {}) 1 (from [::1]:41032) (comment: 02687_native_fuzz.sql) -- It correctly throws exception about incorrect data instead of a low-level exception about the allocator:
2025-06-04 01:54:50 SELECT * FROM format(Native, 'WatchID Int64, JavaEnable Int16, UTMCaTitle String, GoodEvent Int16, EventTime DateTime, EventDate Date, Countem String, FromTag String, HasGCLID Int16, RefererHash Int64, URLHash Int64, CLID Int16', $$
� �'�X+�'�X+�'�URLHashInt64�|3�b.�|3�b.�|3�b.�|3�b.�
2025-06-04 01:54:52 o�e�
�#�\X-h�X v�v�h�9�D�|3�b.�CLIDInt32 � $$); (stage: Complete)
2025-06-04 01:54:52
2025-06-04 01:54:52
2025-06-04 01:54:52
2025-06-04 01:54:52 Top short messages:
2025-06-04 01:54:52
2025-06-04 01:54:52 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate
2025-06-04 01:54:52
2025-06-04 01:54:52 1. 12 Creating {}: {} Creating table test_fbua4qyb.tbl1: CREATE TABLE IF NOT EXISTS test_fbua4qyb.tbl1 UUID '955a74e1-1139-4c1e-9c8d-c7f025015 124
2025-06-04 01:54:52 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate
2025-06-04 01:54:52
2025-06-04 01:54:52 2. 5 {} Server was built with memory sanitizer. It will work slowly. 34
2025-06-04 01:54:52 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate
2025-06-04 01:54:52
2025-06-04 01:54:52 3. 4 Froze {} parts Froze 1 parts -13
2025-06-04 01:54:52 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate
2025-06-04 01:54:52
2025-06-04 01:54:52 4. 2 Unknown table engine {} Code: 56. DB::Exception: Unknown table engine s3. (UNKNOWN_STORAGE) (version 24.8.14.10028.altinitytest (altinity build) 24
2025-06-04 01:54:52
2025-06-04 01:54:52
2025-06-04 01:54:52
2025-06-04 01:54:52 Top messages by level:
2025-06-04 01:54:52
2025-06-04 01:54:52 (0.0036356512153114524,'Number of arguments for function {} doesn\'t match: passed {}, should be {}') Error
2025-06-04 01:54:52 (0.0005156191669972543,'Not enabled four letter command {}') Warning
2025-06-04 01:54:52 (0.0035586494871587436,'Removing metadata {} of dropped table {}') Information
2025-06-04 01:54:52 (0.05708362290206842,'(from {}{}{}){}{} {} (stage: {})') Debug
2025-06-04 01:54:52 (0.05706607820451464,'{} Creating query context from {} context, user_id: {}, parent context user: {}') Trace
2025-06-04 01:54:52
2025-06-04 01:54:52
+ set -e
Files in current directory
+ echo 'Files in current directory'
+ ls -la ./
total 127788
drwxr-xr-x 1 root root 4096 Jun 4 01:47 .
drwxr-xr-x 1 root root 4096 Jun 4 01:47 ..
-rw-rw-r-- 1 1000 1000 119 Jun 4 00:56 analyzer_tech_debt.txt
-rw-rw-r-- 1 root root 2380 Jan 31 08:43 attach_gdb.lib
-rw-r--r-- 1 root root 1542 Jun 4 01:40 __azurite_db_blob_extent__.json
-rw-r--r-- 1 root root 4240 Jun 4 01:40 __azurite_db_blob__.json
-rw-r--r-- 1 root root 497878 Jun 4 01:54 azurite_log
lrwxrwxrwx 1 root root 7 Sep 11 2024 bin -> usr/bin
drwxr-xr-x 2 root root 4096 Jun 4 01:01 __blobstorage__
drwxr-xr-x 2 root root 4096 Apr 18 2022 boot
-rw-rw-r-- 1 1000 1000 292 Jun 4 00:56 broken_tests.json
drwxr-x--- 4 root root 4096 Jun 4 01:41 data
drwxr-xr-x 14 root root 3840 Jun 4 01:00 dev
-rwxr-xr-x 1 root root 0 Jun 4 01:00 .dockerenv
drwxr-xr-x 1 root root 4096 Jun 4 01:00 etc
drwxr-x--- 2 root root 4096 Jun 4 01:41 flags
drwxr-x--- 2 root root 4096 Jun 4 01:41 format_schemas
drwxr-xr-x 1 1000 1000 4096 Jun 4 01:00 hadoop-3.3.1
drwxr-xr-x 2 root root 4096 Apr 18 2022 home
lrwxrwxrwx 1 root root 7 Sep 11 2024 lib -> usr/lib
lrwxrwxrwx 1 root root 9 Sep 11 2024 lib32 -> usr/lib32
lrwxrwxrwx 1 root root 9 Sep 11 2024 lib64 -> usr/lib64
lrwxrwxrwx 1 root root 10 Sep 11 2024 libx32 -> usr/libx32
-rwxr-xr-x 1 root root 26927256 Jan 31 09:05 mc
drwxr-xr-x 2 root root 4096 Sep 11 2024 media
drwxr-x--- 2 root root 4096 Jun 4 01:41 metadata
drwxr-x--- 2 root root 4096 Jun 4 01:41 metadata_dropped
-rwxr-xr-x 1 root root 103174296 Jan 31 09:03 minio
drwxr-xr-x 4 root root 4096 Jun 4 01:00 minio_data
drwxr-xr-x 2 root root 4096 Sep 11 2024 mnt
drwxr-xr-x 1 root root 4096 Jan 31 08:44 opt
-rw-r--r-- 1 root root 0 Feb 14 2024 .package-cache-mutate
drwxrwxr-x 2 1000 1000 4096 Jun 4 01:00 package_folder
drwxr-x--- 2 root root 4096 Jun 4 01:41 preprocessed_configs
dr-xr-xr-x 317 root root 0 Jun 4 01:00 proc
-rwxrwxr-x 1 root root 9627 Jan 31 08:43 process_functional_tests_result.py
-rw-r--r-- 1 root root 29 Jun 4 01:09 queries_02352
-rw-rw-r-- 1 root root 837 Jan 31 08:43 requirements.txt
drwx------ 1 root root 4096 Jun 4 01:18 root
drwxr-xr-x 1 root root 4096 Jun 4 01:00 run
-rwxrwxr-x 1 root root 22124 Jan 31 08:43 run.sh
lrwxrwxrwx 1 root root 8 Sep 11 2024 sbin -> usr/sbin
-rw-r--r-- 1 root root 747 Jun 4 01:01 script.gdb
-rwxrwxr-x 1 root root 10374 Jan 31 08:43 setup_export_logs.sh
-rwxrwxr-x 1 root root 360 Jan 31 08:43 setup_hdfs_minicluster.sh
-rwxrwxr-x 1 root root 3456 Jan 31 08:43 setup_minio.sh
drwxr-xr-x 2 root root 4096 Sep 11 2024 srv
-rw-r----- 1 root root 64 Jun 4 01:41 status
drwxr-x--- 4 root root 4096 Jun 4 01:41 store
-rw-rw-r-- 1 root root 14015 Jan 31 08:43 stress_tests.lib
dr-xr-xr-x 13 root root 0 Jun 4 01:00 sys
drwxrwxr-x 2 1000 1000 4096 Jun 4 01:01 test_output
drwxrwxrwt 1 root root 4096 Jun 4 01:54 tmp
drwxr-x--- 2 root root 4096 Jun 4 01:41 user_files
drwxr-xr-x 1 root root 4096 Sep 11 2024 usr
-rw-rw-r-- 1 root root 897 Jan 31 08:43 utils.lib
-rw-r----- 1 root root 36 Jun 4 01:41 uuid
drwxr-xr-x 1 root root 4096 Sep 11 2024 var
Files in root directory
+ echo 'Files in root directory'
+ ls -la /
total 127788
drwxr-xr-x 1 root root 4096 Jun 4 01:47 .
drwxr-xr-x 1 root root 4096 Jun 4 01:47 ..
-rw-rw-r-- 1 1000 1000 119 Jun 4 00:56 analyzer_tech_debt.txt
-rw-rw-r-- 1 root root 2380 Jan 31 08:43 attach_gdb.lib
-rw-r--r-- 1 root root 1542 Jun 4 01:40 __azurite_db_blob_extent__.json
-rw-r--r-- 1 root root 4240 Jun 4 01:40 __azurite_db_blob__.json
-rw-r--r-- 1 root root 497878 Jun 4 01:54 azurite_log
lrwxrwxrwx 1 root root 7 Sep 11 2024 bin -> usr/bin
drwxr-xr-x 2 root root 4096 Jun 4 01:01 __blobstorage__
drwxr-xr-x 2 root root 4096 Apr 18 2022 boot
-rw-rw-r-- 1 1000 1000 292 Jun 4 00:56 broken_tests.json
drwxr-x--- 4 root root 4096 Jun 4 01:41 data
drwxr-xr-x 14 root root 3840 Jun 4 01:00 dev
-rwxr-xr-x 1 root root 0 Jun 4 01:00 .dockerenv
drwxr-xr-x 1 root root 4096 Jun 4 01:00 etc
drwxr-x--- 2 root root 4096 Jun 4 01:41 flags
drwxr-x--- 2 root root 4096 Jun 4 01:41 format_schemas
drwxr-xr-x 1 1000 1000 4096 Jun 4 01:00 hadoop-3.3.1
drwxr-xr-x 2 root root 4096 Apr 18 2022 home
lrwxrwxrwx 1 root root 7 Sep 11 2024 lib -> usr/lib
lrwxrwxrwx 1 root root 9 Sep 11 2024 lib32 -> usr/lib32
lrwxrwxrwx 1 root root 9 Sep 11 2024 lib64 -> usr/lib64
lrwxrwxrwx 1 root root 10 Sep 11 2024 libx32 -> usr/libx32
-rwxr-xr-x 1 root root 26927256 Jan 31 09:05 mc
drwxr-xr-x 2 root root 4096 Sep 11 2024 media
drwxr-x--- 2 root root 4096 Jun 4 01:41 metadata
drwxr-x--- 2 root root 4096 Jun 4 01:41 metadata_dropped
-rwxr-xr-x 1 root root 103174296 Jan 31 09:03 minio
drwxr-xr-x 4 root root 4096 Jun 4 01:00 minio_data
drwxr-xr-x 2 root root 4096 Sep 11 2024 mnt
drwxr-xr-x 1 root root 4096 Jan 31 08:44 opt
-rw-r--r-- 1 root root 0 Feb 14 2024 .package-cache-mutate
drwxrwxr-x 2 1000 1000 4096 Jun 4 01:00 package_folder
drwxr-x--- 2 root root 4096 Jun 4 01:41 preprocessed_configs
dr-xr-xr-x 317 root root 0 Jun 4 01:00 proc
-rwxrwxr-x 1 root root 9627 Jan 31 08:43 process_functional_tests_result.py
-rw-r--r-- 1 root root 29 Jun 4 01:09 queries_02352
-rw-rw-r-- 1 root root 837 Jan 31 08:43 requirements.txt
drwx------ 1 root root 4096 Jun 4 01:18 root
drwxr-xr-x 1 root root 4096 Jun 4 01:00 run
-rwxrwxr-x 1 root root 22124 Jan 31 08:43 run.sh
lrwxrwxrwx 1 root root 8 Sep 11 2024 sbin -> usr/sbin
-rw-r--r-- 1 root root 747 Jun 4 01:01 script.gdb
-rwxrwxr-x 1 root root 10374 Jan 31 08:43 setup_export_logs.sh
-rwxrwxr-x 1 root root 360 Jan 31 08:43 setup_hdfs_minicluster.sh
-rwxrwxr-x 1 root root 3456 Jan 31 08:43 setup_minio.sh
drwxr-xr-x 2 root root 4096 Sep 11 2024 srv
-rw-r----- 1 root root 64 Jun 4 01:41 status
drwxr-x--- 4 root root 4096 Jun 4 01:41 store
-rw-rw-r-- 1 root root 14015 Jan 31 08:43 stress_tests.lib
dr-xr-xr-x 13 root root 0 Jun 4 01:00 sys
drwxrwxr-x 2 1000 1000 4096 Jun 4 01:01 test_output
drwxrwxrwt 1 root root 4096 Jun 4 01:54 tmp
drwxr-x--- 2 root root 4096 Jun 4 01:41 user_files
drwxr-xr-x 1 root root 4096 Sep 11 2024 usr
-rw-rw-r-- 1 root root 897 Jan 31 08:43 utils.lib
-rw-r----- 1 root root 36 Jun 4 01:41 uuid
drwxr-xr-x 1 root root 4096 Sep 11 2024 var
+ /process_functional_tests_result.py
2025-06-04 01:54:52,954 File /analyzer_tech_debt.txt with broken tests found
2025-06-04 01:54:52,954 File /broken_tests.json with broken tests found
2025-06-04 01:54:52,955 Broken tests in the list: 4
2025-06-04 01:54:52,955 Find files in result folder test_result.txt,gdb.log,run.log,minio.log,hdfs_minicluster.log
2025-06-04 01:54:52,970 Is flaky check: False
2025-06-04 01:54:52,970 Result parsed
2025-06-04 01:54:52,974 Result written
+ clickhouse-client -q 'system flush logs'
Detach all logs replication
+ stop_logs_replication
+ echo 'Detach all logs replication'
+ clickhouse-client --query 'select database||'\''.'\''||table from system.tables where database = '\''system'\'' and (table like '\''%_sender'\'' or table like '\''%_watcher'\'')'
+ tee /dev/stderr
+ timeout --preserve-status --signal TERM --kill-after 5m 15m xargs -n1 -r -i clickhouse-client --query 'drop table {}'
xargs: warning: options --max-args and --replace/-I/-i are mutually exclusive, ignoring previous --max-args value
+ failed_to_save_logs=0
+ for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log
+ clickhouse-client -q 'select * from system.query_log into outfile '\''/test_output/query_log.tsv.zst'\'' format TSVWithNamesAndTypes'
+ [[ 0 -eq 1 ]]
+ [[ 0 -eq 1 ]]
+ for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log
+ clickhouse-client -q 'select * from system.zookeeper_log into outfile '\''/test_output/zookeeper_log.tsv.zst'\'' format TSVWithNamesAndTypes'
+ [[ 0 -eq 1 ]]
+ [[ 0 -eq 1 ]]
+ for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log
+ clickhouse-client -q 'select * from system.trace_log into outfile '\''/test_output/trace_log.tsv.zst'\'' format TSVWithNamesAndTypes'
+ [[ 0 -eq 1 ]]
+ [[ 0 -eq 1 ]]
+ for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log
+ clickhouse-client -q 'select * from system.transactions_info_log into outfile '\''/test_output/transactions_info_log.tsv.zst'\'' format TSVWithNamesAndTypes'
+ [[ 0 -eq 1 ]]
+ [[ 0 -eq 1 ]]
+ for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log
+ clickhouse-client -q 'select * from system.metric_log into outfile '\''/test_output/metric_log.tsv.zst'\'' format TSVWithNamesAndTypes'
+ [[ 0 -eq 1 ]]
+ [[ 0 -eq 1 ]]
+ for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log
+ clickhouse-client -q 'select * from system.blob_storage_log into outfile '\''/test_output/blob_storage_log.tsv.zst'\'' format TSVWithNamesAndTypes'
+ [[ 0 -eq 1 ]]
+ [[ 0 -eq 1 ]]
+ for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log
+ clickhouse-client -q 'select * from system.error_log into outfile '\''/test_output/error_log.tsv.zst'\'' format TSVWithNamesAndTypes'
+ [[ 0 -eq 1 ]]
+ [[ 0 -eq 1 ]]
+ sleep 1
+ clickhouse-client -q 'SYSTEM FLUSH ASYNC INSERT QUEUE'
+ clickhouse-client -q 'SELECT log FROM minio_audit_logs ORDER BY event_time INTO OUTFILE '\''/test_output/minio_audit_logs.jsonl.zst'\'' FORMAT JSONEachRow'
+ clickhouse-client -q 'SELECT log FROM minio_server_logs ORDER BY event_time INTO OUTFILE '\''/test_output/minio_server_logs.jsonl.zst'\'' FORMAT JSONEachRow'
+ sudo clickhouse stop
script.gdb:13: Error in sourced command file:
No stack.
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 592.
The process with pid = 592 is running.
Sent terminate signal to process with pid 592.
Waiting for server to stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 592.
The process with pid = 592 is running.
Waiting for server to stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 592.
The process with pid = 592 is running.
Waiting for server to stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 592.
The process with pid = 592 is running.
Waiting for server to stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 592.
The process with pid = 592 is running.
Waiting for server to stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 592.
The process with pid = 592 is running.
Waiting for server to stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 592.
The process with pid = 592 is running.
Waiting for server to stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 592.
The process with pid = 592 is running.
Waiting for server to stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 592.
The process with pid = 592 is running.
Waiting for server to stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 592.
The process with pid = 592 does not exist.
Server stopped
+ [[ 0 -eq 1 ]]
+ [[ 0 -eq 1 ]]
+ kill 1481
+ rg -Fa '' /var/log/clickhouse-server/clickhouse-server.log
+ :
+ rg -A50 -Fa ============ /var/log/clickhouse-server/stderr.log
+ :
+ data_path_config=--path=/var/lib/clickhouse/
+ [[ -n '' ]]
+ zstd --threads=0
+ '[' 0 -ne 0 ']'
+ for trace_type in CPU Memory Real
+ clickhouse-local --path=/var/lib/clickhouse/ --only-system-tables -q '
select
arrayStringConcat((arrayMap(x -> concat(splitByChar('\''/'\'', addressToLine(x))[-1], '\''#'\'', demangle(addressToSymbol(x)) ), trace)), '\'';'\'') AS stack,
count(*) AS samples
from system.trace_log
where trace_type = '\''CPU'\''
group by trace
order by samples desc
settings allow_introspection_functions = 1
format TabSeparated'
+ zstd --threads=0
+ for trace_type in CPU Memory Real
+ clickhouse-local --path=/var/lib/clickhouse/ --only-system-tables -q '
select
arrayStringConcat((arrayMap(x -> concat(splitByChar('\''/'\'', addressToLine(x))[-1], '\''#'\'', demangle(addressToSymbol(x)) ), trace)), '\'';'\'') AS stack,
count(*) AS samples
from system.trace_log
where trace_type = '\''Memory'\''
group by trace
order by samples desc
settings allow_introspection_functions = 1
format TabSeparated'
+ zstd --threads=0
+ for trace_type in CPU Memory Real
+ clickhouse-local --path=/var/lib/clickhouse/ --only-system-tables -q '
select
arrayStringConcat((arrayMap(x -> concat(splitByChar('\''/'\'', addressToLine(x))[-1], '\''#'\'', demangle(addressToSymbol(x)) ), trace)), '\'';'\'') AS stack,
count(*) AS samples
from system.trace_log
where trace_type = '\''Real'\''
group by trace
order by samples desc
settings allow_introspection_functions = 1
format TabSeparated'
+ zstd --threads=0
+ check_logs_for_critical_errors
+ sed -n '/WARNING:.*anitizer/,/^$/p' /var/log/clickhouse-server/stderr.log
+ rg -Fav -e 'ASan doesn'\''t fully support makecontext/swapcontext functions' -e DB::Exception /test_output/tmp
+ echo -e 'No sanitizer asserts\tOK\t\N\t'
+ rm -f /test_output/tmp
+ rg -Fa ' Application: Child process was terminated by signal 9' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.log
+ echo -e 'No OOM messages in clickhouse-server.log\tOK\t\N\t'
+ rg -Fa 'Code: 49. DB::Exception: ' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.log
+ echo -e 'No logical errors\tOK\t\N\t'
+ '[' -s /test_output/logical_errors.txt ']'
+ rm /test_output/logical_errors.txt
+ rg --text 'Code: 499.*The specified key does not exist' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.log
+ grep -v a.myext
+ echo -e 'No lost s3 keys\tOK\t\N\t'
+ grep SharedMergeTreePartCheckThread
+ rg -Fa 'it is lost forever' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.log
+ echo -e 'No SharedMergeTree lost forever in clickhouse-server.log\tOK\t\N\t'
+ '[' -s /test_output/no_such_key_errors.txt ']'
+ rm /test_output/no_such_key_errors.txt
+ rg -Fa '########################################' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.log
+ echo -e 'Not crashed\tOK\t\N\t'
+ rg -Fa ' ' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.log
+ echo -e 'No fatal messages in clickhouse-server.log\tOK\t\N\t'
+ '[' -s /test_output/fatal_messages.txt ']'
+ rm /test_output/fatal_messages.txt
+ rg -Faz '########################################' /test_output/blob_storage_log.tsv.zst /test_output/check_status.tsv /test_output/clickhouse-server.log.zst /test_output/error_log.tsv.zst /test_output/gdb.log /test_output/hdfs_minicluster.log /test_output/metric_log.tsv.zst /test_output/minio_audit_logs.jsonl.zst /test_output/minio.log /test_output/minio_server_logs.jsonl.zst /test_output/query_log.tsv.zst /test_output/run.log /test_output/test_results.tsv /test_output/test_result.txt /test_output/trace-log-CPU-flamegraph.tsv.zst /test_output/trace-log-Memory-flamegraph.tsv.zst /test_output/trace-log-Real-flamegraph.tsv.zst /test_output/trace_log.tsv.zst /test_output/transactions_info_log.tsv.zst /test_output/zookeeper_log.tsv.zst
+ rg -Fa ' received signal ' /test_output/gdb.log
+ dmesg -T
+ grep -q -F -e 'Out of memory: Killed process' -e 'oom_reaper: reaped process' -e oom-kill:constraint=CONSTRAINT_NONE /test_output/dmesg.log
+ echo -e 'No OOM in dmesg\tOK\t\N\t'
+ rm /var/log/clickhouse-server/clickhouse-server.log
+ mv /var/log/clickhouse-server/stderr.log /test_output/
+ [[ -n '' ]]
+ tar -chf /test_output/coordination.tar /var/lib/clickhouse/coordination
tar: Removing leading `/' from member names
tar: Removing leading `/' from hard link targets
+ rm -rf /var/lib/clickhouse/data/system/asynchronous_insert_log/ /var/lib/clickhouse/data/system/asynchronous_metric_log/ /var/lib/clickhouse/data/system/backup_log/ /var/lib/clickhouse/data/system/blob_storage_log/ /var/lib/clickhouse/data/system/crash_log/ /var/lib/clickhouse/data/system/error_log/ /var/lib/clickhouse/data/system/filesystem_cache_log/ /var/lib/clickhouse/data/system/metric_log/ /var/lib/clickhouse/data/system/opentelemetry_span_log/ /var/lib/clickhouse/data/system/part_log/ /var/lib/clickhouse/data/system/processors_profile_log/ /var/lib/clickhouse/data/system/query_log/ /var/lib/clickhouse/data/system/query_thread_log/ /var/lib/clickhouse/data/system/query_views_log/ /var/lib/clickhouse/data/system/s3queue_log/ /var/lib/clickhouse/data/system/session_log/ /var/lib/clickhouse/data/system/text_log/ /var/lib/clickhouse/data/system/trace_log/ /var/lib/clickhouse/data/system/transactions_info_log/ /var/lib/clickhouse/data/system/zookeeper_log/
+ tar -chf /test_output/store.tar /var/lib/clickhouse/store
tar: Removing leading `/' from member names
tar: Removing leading `/' from hard link targets
+ tar -chf /test_output/metadata.tar /var/lib/clickhouse/metadata/default.sql /var/lib/clickhouse/metadata/information_schema.sql /var/lib/clickhouse/metadata/INFORMATION_SCHEMA.sql /var/lib/clickhouse/metadata/system.sql /var/lib/clickhouse/metadata/test_3iyayh5z.sql /var/lib/clickhouse/metadata/test_jcu15pm3_1.sql /var/lib/clickhouse/metadata/test_n3w0npc2.sql /var/lib/clickhouse/metadata/test.sql
tar: Removing leading `/' from member names
tar: Removing leading `/' from hard link targets
+ [[ 0 -eq 1 ]]
+ [[ 0 -eq 1 ]]
+ collect_core_dumps
+ find . -type f -maxdepth 1 -name 'core.*'
+ read -r core